(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE284

PENCW_10.PE284       Location/Qualifiers
FT   CDS_pept        join(653681..653942,653997..655003)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824878"
FT                   /orf_name="Pc13g02840"
FT                   /product="Pc13g02840 protein"
FT                   /protein_id="CAP91353.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0001830DD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F2"
FT                   /transl_table=1
FT                   /translation="MSFKVSPRIQEVRGLAKEDPSKAATSYQKILSEGPGSTEASSRDY
FT                   EHALIGLGEVYRDAKKPQEIADLIKTSRDTFSSFAKAKTAKLVRQLLDLISEIPNTLEL
FT                   QGNVIQSCIEWAIAERRSFLRQALQARLVAIYMQKQSYYDALTLINSLLSELKRLDDKL
FT                   MLVEVQLLESRVYHALGNQAKARAALTAARTSAASVYTPPNLQAGLDMQSGMLHAEDKD
FT                   FTTSYSYFIEALEGYSSLDESDLATATLQYMLLCKIMLNLVDDVTQLQGSKQAQKYASP
FT                   RLEAMKAVARAHANRSLEEYEKALSTYRYELGSDVFIRNHLRRLYDAMLEQNLIKVIEP
FT                   FSRVELDHIAKMVGLDTQQVERKLSQMILDKVIIGVLDQGSGCLIVYDETERDQAYDAA
FT                   LETIEKLGNVVEGLYTNQASLLE"
     atgtcattca aggtctcacc acggattcaa gaagtccgag gtctggcgaa ggaggatccc        60
     tccaaagcag cgaccagtta ccagaagatc ctctcagagg gccccggatc tacagaggcc       120
     tcttcacgag actacgaaca tgccttgatt gggttgggtg aggtgtatcg ggatgcgaag       180
     aagccacagg agattgcgga cctcatcaag accagccgtg acaccttctc gtcatttgcc       240
     aaagccaaga cggccaagct agtccgtcaa cttctggacc tgattagcga aatccccaac       300
     acactcgaac tccaaggcaa cgtcatccaa tcatgcatag aatgggctat tgccgagcgg       360
     cgatcgttcc ttcgccaggc ccttcaagct cgactagttg ccatctatat gcagaagcaa       420
     tcctactacg atgcgctcac tcttatcaac tcgcttctta gtgagctgaa gcgcctggat       480
     gataagctta tgctggtgga agtacaactg cttgagtcgc gtgtgtacca cgctctgggc       540
     aaccaggcca aggcacgtgc tgctctgacg gcagcacgga cgtcggccgc ctccgtctac       600
     acgccgccga acctgcaggc cggtctggac atgcagagtg gcatgctaca cgccgaagac       660
     aaggacttca ccacttcata ctcctatttc attgaggcgc ttgaggggta cagctcgctc       720
     gatgagagcg atctggccac ggcgacactg cagtacatgc ttctgtgcaa gatcatgctg       780
     aacctagtgg atgatgtcac acagctgcaa ggctcgaaac aagcgcaaaa gtatgccagt       840
     ccacgcctgg aggcaatgaa ggccgtggca cgggcccacg ccaaccggtc tctagaggag       900
     tatgagaagg ccctttcgac ctacagatat gaattgggca gcgatgtctt catccgaaac       960
     cacctccgtc gtctttatga tgccatgctg gaacagaact tgatcaaggt cattgagccc      1020
     ttcagccggg tcgagctgga ccacattgcg aagatggtgg gtttggatac acagcaggtg      1080
     gaaaggaagt tgtctcaaat gatcttggac aaggtgatca ttggtgtatt ggaccagggc      1140
     tcaggatgtc tgattgtgta cgatgagacg gaacgggacc aggcttacga tgccgcactg      1200
     gagacaattg aaaagctcgg caatgtggtg gaaggtctgt atactaacca ggcgtctctt      1260
     ctcgaatag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page