(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE285

PENCW_10.PE285       Location/Qualifiers
FT   CDS_pept        join(655342..655432,655494..656362,656415..656939)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949860"
FT                   /orf_name="Pc13g02850"
FT                   /product="Pc13g02850 protein"
FT                   /protein_id="CAP91354.1"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI0001830DD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F3"
FT                   /transl_table=1
FT                   /translation="MQAPMQQHYARAMPPNAQRSPAAPRRPPGPGGAMPVPMPQHAVAQ
FT                   QYMASRPMPHPNDAALRRSRKPTDKNLPDGIEEVIIGEGVQQYKNLRDLEKRLDAAVVR
FT                   KRLDIQDSINKTVKKYRTMRIWISNTVENQPWQGPGNNPGSGRYKVRIEGRLLDDETDP
FT                   TVPDKDEKDEDAMDHDGAQDDKAKKSESKSQSQRFSHFFKAINIDFDKPVSAIPDEVKP
FT                   VNWSKPNAHPNTPAPPNAEFDSLQFSRASQDNLNVTISLVRDEVPERYKLSKELAEVLD
FT                   VEEETRSGIVLGIWDYIRAMELQEDEEKRQVRCDHRLRSIFGREQMFFPQIPESVGPHT
FT                   SPMEPIKLPYTIRVDEDFHANPTPTIYDIQVAVEDPLRTKMMALTQNPAYTSGLRQISS
FT                   LDDQVALIVQALTHSRARHSFYTALSKDPANFVRRWISSQRRDLETIMGEATRGGGEDG
FT                   SGPEFRYGSVDGPWDSEVAKEAVRYMLAKPEAAAAR"
     atgcaagctc caatgcagca acattatgct cgggctatgc ccccaaatgc gcagcgatct        60
     ccagccgcgc cccgtcgccc cccagggcca ggtggcgcga tgcctgttcc gatgccacag       120
     cacgctgttg cccaacagta catggcctca cgacccatgc cccacccgaa tgatgctgcc       180
     cttcggcgca gccgcaagcc gaccgacaag aacctccccg acggcattga agaagtgatc       240
     atcggcgagg gtgttcagca atataagaac cttcgcgact tagaaaaacg attggatgct       300
     gctgttgtgc gaaagagact ggatattcaa gactccatca acaagaccgt caagaagtat       360
     cggactatgc gcatctggat ctctaatacc gtcgaaaacc agccatggca aggcccgggc       420
     aacaacccag gctccggtcg ctacaaagtg cgcatcgaag gacgtctgct agatgatgaa       480
     accgacccta cggttcccga taaagacgag aaagatgaag atgcgatgga ccacgatgga       540
     gctcaagacg ataaggcaaa gaaatccgag tctaagagcc aatcccagcg attctcgcat       600
     ttcttcaagg ctatcaacat cgattttgac aagcccgtct ctgctatccc cgacgaggtc       660
     aagccagtta actggtccaa accaaacgca caccccaaca caccagcgcc cccgaatgcc       720
     gaatttgata gtctacaatt ctcccgggcc tcgcaagaca atctgaatgt caccatcagc       780
     cttgtccggg acgaagtccc agagcgatac aagttgagca aggagctggc cgaggttctg       840
     gatgtcgaag aggagacccg aagtggaatt gtgctcggaa tctgggatta catccgagcc       900
     atggaattgc aggaagatga ggagaagcga caagtgcgct gtgatcatcg tctacgctcg       960
     atctttggcc gggagcaaat gttctttccc cagatccctg aaagcgtcgg tcctcacacc      1020
     agcccaatgg agccaatcaa acttccctac accattcgtg tcgacgaaga cttccatgcc      1080
     aacccaaccc cgaccatcta cgatatccag gtcgccgttg aagacccgct gcgcaccaaa      1140
     atgatggctc tcactcagaa cccggcatac acaagcggcc tgcgccagat ctcctccctg      1200
     gatgaccaag tagctttaat tgtccaggct cttacgcact cccgcgctcg tcactccttc      1260
     tacactgctc tgagcaagga cccggccaat ttcgttcgtc gctggatcag ctctcagcgc      1320
     cgcgacctgg agactataat gggcgaagct acccgtggag gcggcgagga tggtagcgga      1380
     cctgaattcc gctatggcag cgtggatggc ccgtgggact ctgaggtggc caaggaagct      1440
     gtgcgataca tgctggctaa acccgaagct gcggctgccc ggtag                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page