(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE286

PENCW_10.PE286       Location/Qualifiers
FT   CDS_pept        join(complement(658207..658690),complement(657372..658111))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672174"
FT                   /orf_name="Pc13g02860"
FT                   /product="Pc13g02860 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91355.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI0001830DD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F4"
FT                   /transl_table=1
FT                   /translation="MLDPFPPPPEWLRSLAEPYAIRLNSPTLADHIHEVIAAFAFYLFI
FT                   HAVLSPRLSPILFARSYNKLTPRTKLNWDIHVVSLVQSVVINAAALWVMYYDEERSSMT
FT                   SGERVFGYTGACGLIQALAVGYFVYDLIVSIVHVRMFGIGMLFHAVSALWVFSLGFVIS
FT                   QRPFLNYFAPTFILYELSSPFLNIHWFLDKVNMTGSRAQWYNGMALLFSFFSCRLVWGT
FT                   WQTVVVYGDMWNALQQTWSAAAAPLSEPASVNANVFYPARDGSLCVNEACARANAEITK
FT                   FKEYTAGGVPTWLVVTYVGSNLILNFLNFFWFSKMVETVLKRFRAPAAAAEKKPGRAEK
FT                   AAQLKEDIVHDVVLEAASKLEQEETAILQGDLSSLQEQVSSGVDSGLGEELRKRKAELV
FT                   AKISLPGV"
     atgttggacc cgttcccacc ccctccggaa tggctgcgga gcctcgcaga gccctatgcc        60
     atccgactga acagtccgac acttgccgac catatccacg aggttatcgc agcgttcgcc       120
     ttctacctgt tcatccatgc agttctgtcg cctcgactct cgccaatcct ctttgctcgg       180
     tcttacaaca agctcactcc tcggacgaag ctgaactggg atattcatgt tgtctctcta       240
     gttcagagcg ttgtcatcaa tgctgctgcc ctctgggtga tgtactacga cgaggagcgc       300
     agctccatga cctccggtga gcgcgtcttc ggatatacag gtgcttgtgg tctcattcaa       360
     gctttggccg tgggatactt tgtatatgac ttgatcgtca gcattgtgca tgtccgcatg       420
     tttggcattg gcatgctttt ccatgctgtc agcgccttgt gggtgtttag tctaggcttt       480
     gtaatttcgc agagaccgtt ccttaactac ttcgccccga ccttcatcct ctatgagctc       540
     tccagcccat tcctcaatat ccactggttc ctcgataaag tcaacatgac tggcagccgt       600
     gcccaatggt ataatggcat ggccttgctt ttcagcttct tctcctgtcg cctcgtctgg       660
     ggcacttggc aaaccgtcgt ggtgtacggg gacatgtgga atgcacttca gcaaacctgg       720
     tccgcagccg cagccccgct ctctgaaccc gcgagcgtca acgcgaatgt cttctaccca       780
     gcccgagacg gtagcttgtg tgtcaacgag gcctgcgcgc gcgccaacgc cgagatcacc       840
     aagttcaagg agtacaccgc gggaggcgta ccgacatggc tggtcgtgac ctacgtcgga       900
     tcgaacttga tcttgaactt cttgaacttt ttctggttct ccaagatggt tgagactgtt       960
     ctcaagcgct tccgcgctcc ggctgctgct gctgagaaga agcctggtag ggcagagaag      1020
     gctgcgcagc ttaaggagga tattgtgcac gatgttgtcc ttgaggcggc ttccaagctg      1080
     gagcaggagg agaccgccat tttgcagggt gatctttcct cgttgcagga acaggtctct      1140
     tcaggcgtgg actcgggtct cggggaggag ttgcgtaaac ggaaggcaga gcttgtcgca      1200
     aaaatctctt tgcctggtgt ttga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page