(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE290

PENCW_10.PE290       Location/Qualifiers
FT   CDS_pept        672032..672823
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978071"
FT                   /orf_name="Pc13g02900"
FT                   /product="Putative uncharacterized protein Pc13g02900 "
FT                   /protein_id="CAP91359.1"
FT                   /db_xref="UniParc:UPI0001830EA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F7"
FT                   /transl_table=1
FT                   /translation="MAIPLKTIHEDSREEWMDNEVHRHYNMPMVAVRAEPRVLMHCNVC
FT                   RDTASVQKTSVSIDKWVNTEYFIWEMSAGLADSGANPQWTELFEEQYQERWMQIQSEFE
FT                   SIADLPERFLHKVPVPPFLVAEVRIKTNKFPCHWRLRADTGRHMIDTSFWHLWKSILQQ
FT                   DSFIVGPFDVILKVPSHTPAGEDVVDPWNMSLSNDRHSAASDDFSYLRWDRAYNDSAPL
FT                   DFTCLGEGAQRDSSPPAGRRRSRSTSAIRELSQRMRDSLFL"
     atggccattc ctctgaaaac catccacgag gactctaggg aggaatggat ggacaacgag        60
     gtccatcgac actacaacat gcccatggtc gccgtgcgag ccgagcctcg tgttctgatg       120
     cactgcaacg tgtgccgcga cactgcttca gtccaaaaga catcggtcag tatcgacaag       180
     tgggttaaca ctgaatattt tatctgggag atgtccgcgg ggctagctga cagcggcgca       240
     aacccacagt ggacggagtt attcgaagaa caataccagg aaagatggat gcagatccag       300
     agcgagttcg agagcatagc cgatctgccc gagagattcc tccacaaggt tccggtcccg       360
     cccttcctgg ttgcagaggt gagaatcaag actaacaaat tcccgtgtca ttggcggctc       420
     cgtgcggata caggccggca catgattgac acgagcttct ggcatctttg gaagtctatc       480
     ctccagcaag attctttcat tgttggtccc tttgatgtta ttctcaaagt gccatcgcac       540
     acgcctgccg gggaggatgt tgtcgatcct tggaatatgt ctctatcaaa cgatcgccat       600
     agtgctgcca gtgatgattt ttcgtatctt cgctgggacc gcgcatacaa tgattctgct       660
     ccattggatt tcacatgtct cggtgaagga gcgcagcgag atagcagccc tccagctggc       720
     cgccgccggt cacgctctac ctcagctatt agggaactgt cgcaacgcat gcgagattct       780
     ttgtttcttt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page