(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE292

PENCW_10.PE292       Location/Qualifiers
FT   CDS_pept        join(675394..675465,675553..676044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949863"
FT                   /orf_name="Pc13g02920"
FT                   /product="Pc13g02920 protein"
FT                   /protein_id="CAP91361.1"
FT                   /db_xref="UniParc:UPI0001830EA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F9"
FT                   /transl_table=1
FT                   /translation="MPHAEAKMGEPVVNGEKHYSQFFDHLTSYPIISDSISYYKGNPYG
FT                   AKSLEYADQGYTRLAKPVLPYFSTPYSYVAPYIARADSLGDKGLSQIDARFPIFKEDTQ
FT                   KLRGSIYNSASLPVRVVGDVKHHVTDIYGSEYKKCGGDSVFASGKAVITTSLVLSQESL
FT                   AWVNAFLQSKKEEAKEVVNEKNSH"
     atgcctcacg cagaagccaa aatgggtgaa ccagtcgtca acggcgagaa gcactactct        60
     cagttctttg accatctgac ttcctatccc atcatctccg actccatatc ctactacaag       120
     ggcaacccct acggagccaa gtccctcgaa tacgccgacc agggctacac ccgtcttgcc       180
     aaacctgttc taccctactt ctccactccc tacagctatg tcgctcccta catcgcccgc       240
     gccgactccc tcggtgataa gggtctgagc caaattgacg cccgcttccc catcttcaag       300
     gaggacaccc agaagctgcg cggctctatc tacaacagtg cctctctgcc cgtccgcgtc       360
     gtcggcgatg tcaagcacca tgtcaccgat atctatggct ctgagtacaa aaagtgcggc       420
     ggcgatagtg tctttgcttc aggcaaggct gtcatcacta ccagcttggt tctgtcgcag       480
     gaatcgctag cttgggtaaa cgctttcctc caaagtaaga aggaggaagc gaaggaggtt       540
     gtcaatgaga agaacagcca ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page