(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE293

PENCW_10.PE293       Location/Qualifiers
FT   CDS_pept        join(676663..676876,676960..677651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949864"
FT                   /orf_name="Pc13g02930"
FT                   /product="Pc13g02930 protein"
FT                   /protein_id="CAP91362.1"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI0001830EA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G0"
FT                   /transl_table=1
FT                   /translation="MVKKLVRLAIASEYSRLPIRRNDISAKVLGEQGSRQFKLVFDQAQ
FT                   REMRQRFGMEMTELPAREKVTITQRRAAQKTEKPSSANKSWIVTSTLPLPYRSSDILIP
FT                   TKAPSLYTESTYTGLYSFIIAVIVLNGGSLAEQKLDRYLSRTNAEVATPIDRTDKLLQR
FT                   LCKEGYIIKTREMDGGEEVIEYVLGPRGKIEVGTSGVAGLVRTVYGKEKGDHEGLTHLQ
FT                   REELEDFEGKLGRSLGIEPAPVRANGVDGASDVGDARVNGSAEDCEAPQSSGPRRSSRR
FT                   APTQEEDEEEDDDSEEYEEE"
     atggtcaaga aattggtgcg gctcgccata gcaagcgagt attcgcggct cccgatccgg        60
     cgcaacgaca tcagcgccaa ggtgctgggc gagcagggct cacggcaatt caagctagtt       120
     ttcgaccagg cgcagcggga aatgaggcag cgttttggta tggagatgac cgagttaccg       180
     gcacgagaga aagtcaccat tacccagcga cgggctgcgc agaaaacgga aaagccttcc       240
     tcggctaata agtcctggat cgttactagc actttgccgc ttccataccg ctcttccgat       300
     atcctcattc cgactaaagc accctccctc tacaccgaaa gcacatacac gggtctgtac       360
     agtttcatca tagcggtgat tgtgctgaac ggtggttcgc tggctgaaca gaaacttgac       420
     cggtacctgt cgcgtacaaa cgctgaggtt gcgacgccga tcgaccgtac ggataaactg       480
     cttcagcggc tatgcaagga gggatacatt atcaagacgc gagagatgga tggcggtgaa       540
     gaggtgattg agtacgtcct tggaccgcgg ggtaaaatcg aggtcgggac tagtggtgtg       600
     gcgggtcttg tgcgaactgt ttatgggaaa gagaagggtg accatgaggg attgactcac       660
     ctccagaggg aagagctcga ggatttcgaa gggaagcttg ggaggagtct tgggatcgaa       720
     ccggcgcccg tacgagctaa tggggtggat ggtgctagcg atgtgggtga tgctcgagtt       780
     aacgggagcg cagaggattg cgaggcgccg cagagctcag ggcctagacg gtcctcgaga       840
     cgtgccccta cccaggagga agacgaagaa gaagatgatg attctgaaga gtatgaggaa       900
     gagtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page