(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE294

PENCW_10.PE294       Location/Qualifiers
FT   CDS_pept        join(complement(680142..680146),complement(679806..680074),
FT                   complement(678639..679747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824879"
FT                   /orf_name="Pc13g02940"
FT                   /product="Pc13g02940 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91363.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0001830EA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G1"
FT                   /transl_table=1
FT                   /translation="MGKEERSHLNIVVIGHVDSGKSTTTGHMIYKCGGIDQRTIEKFEK
FT                   EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFQTSKYEVTVIDAPGHRDFIKNMI
FT                   TGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVKQLIVALNKMDTCKWSE
FT                   ERYNEIVKETSNFIKKVGYNPKAVPFVPISGFNGDNMLEASTNCPWYKGWEKETKAGKA
FT                   TGKTLLEAIDAIEPPVRPSNKPLRLPLQDVYKISGIGTVPVGRVETGIISPGMVVTFAP
FT                   ANVTTEVKSVEMHHQQLKAGNPGDNVGFNVKNVSVKEVRRGNVASDSKNDPAAGCDSFN
FT                   AQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKATETSPKFIKSGDAA
FT                   IVKMVPSKPMCVETFTDYPPLGRFAVRDMRQTVAVGVIKSVVKNAGGAGKVTKAAAKAG
FT                   KK"
     atgggtaaag aagagcgtag ccacctcaac atcgtcgtta tcggccacgt cgattccggc        60
     aagtccacca ccactggtca catgatctac aagtgtggtg gtattgacca gcgtaccatc       120
     gagaagttcg agaaggaggc tgctgagctc ggaaagggtt ccttcaagta cgcctgggtt       180
     cttgacaagc tcaaggccga gcgtgagcgt ggtatcacca tcgatatcgc tctctggaag       240
     ttccagacct ccaagtatga ggtcaccgtc atcgatgccc ccggtcaccg tgatttcatc       300
     aagaacatga tcactggtac ctcccaggcc gattgcgcta ttctcatcat cgcctccggc       360
     actggtgagt tcgaggctgg tatctccaag gatggccaga cccgtgagca cgctctgctt       420
     gccttcaccc tcggtgtcaa gcagctcatt gttgccctca acaagatgga cacctgcaag       480
     tggtccgagg agcgttacaa cgagattgtc aaggagacct ccaacttcat caagaaggtc       540
     ggctacaacc ccaaggccgt tcccttcgtc cccatctccg gcttcaacgg cgacaacatg       600
     cttgaggcct ccaccaactg cccctggtac aagggttggg agaaggagac caaggctggc       660
     aaggccaccg gaaagaccct tctcgaggcc atcgacgcca tcgagccccc cgtccgtcct       720
     tccaacaagc ccctgcgtct tcccctccag gatgtgtaca agatctccgg tattggcaca       780
     gttcccgtcg gtcgtgtcga gactggtatc atcagccccg gcatggtcgt caccttcgct       840
     cccgccaacg tcaccactga agtcaagtcc gtcgagatgc accaccagca gctcaaggcc       900
     ggtaaccccg gtgacaacgt cggcttcaac gtcaagaacg tctccgtcaa ggaggttcgc       960
     cgtggtaacg tcgcttccga ctccaagaac gaccccgccg ctggctgtga ctccttcaac      1020
     gcccaggtca ttgtcctgaa ccaccccggt caggtcggcg ctggatacgc tcccgtcctc      1080
     gattgccaca ctgcccacat tgcttgcaag ttcgctgagc tcctcgagaa gatcgatcgc      1140
     cgtaccggta aggccaccga gacctccccc aagttcatca agtccggtga tgccgctatc      1200
     gtcaagatgg ttccctccaa gcccatgtgt gttgagacct tcaccgacta cccccctctc      1260
     ggtcgtttcg ccgtccgtga catgcgccag accgttgccg tcggtgtcat caagtccgtt      1320
     gttaagaacg ctggtggcgc tggcaaggtc accaaggccg ctgccaaggc tggtaagaaa      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page