(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE295

PENCW_10.PE295       Location/Qualifiers
FT   CDS_pept        join(complement(681874..681883),complement(681596..681805),
FT                   complement(681414..681508),complement(681324..681359))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129242"
FT                   /orf_name="Pc13g02950"
FT                   /product="Pc13g02950 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91364.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniParc:UPI0001830EA8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G4"
FT                   /transl_table=1
FT                   /translation="MLVFCPNCSNALTISKAESSTRFPAGVNRFECRVCPYEAPLEKNY
FT                   FEKKAMKQKEVDDVFGGKEEFANADSVATQCPAESCNGERAYFFQLQIRSADEPMTTFL
FT                   KCTSCGARWREN"
     atgctagtct tctgccccaa ttgcagcaat gcgctcacca tttccaaagc ggagtcgagc        60
     acaagattcc cagcgggtgt gaaccgcttt gaatgccgcg tctgccccta cgaagccccg       120
     ttggagaaga actatttcga gaagaaagct atgaagcaga aggaagtcga cgatgtattt       180
     ggtggcaagg aggaatttgc caatgctgac agtgttgcca ctcaatgccc cgccgaaagc       240
     tgcaatgggg aacgtgcgta cttcttccag ctgcagattc gcagtgcaga tgaaccgatg       300
     actacattct tgaagtgtac ctcgtgcggt gctcggtgga gagaaaatta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page