(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE297

PENCW_10.PE297       Location/Qualifiers
FT   CDS_pept        join(complement(684657..685036),complement(683264..684599))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949865"
FT                   /orf_name="Pc13g02970"
FT                   /product="Pc13g02970 protein"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP91366.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001830EAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G6"
FT                   /transl_table=1
FT                   /translation="MALLSNAILATLVLTATAVLLPKLTGVLLGLVFRGVGWLIWRRTR
FT                   SRREYVIARARSEEEELRASRPKGSTLSRNGAEDEDWEKVDSSGTGGVQTTAGSGSSSG
FT                   SGNESYESPEDWDGIIGFFHPFCNAGGGGERVLWEAIRATQKRWPKAICAIYTGDHEVN
FT                   KATMLEKVENRFNIRLHAPTVVLLYLTTRKYVVSSSYPYMTLLGQSLGSLIVAYDAFTL
FT                   LVPDVFVDTMGYAFTLALCKWFFPRIPVGAYVHYPTISTDMLASLDDKSGVQGINSGAG
FT                   RGWKGKTKRRYWEIFAKLYGWVGRQVDVVMCNSSWTAAHIRTLWGTGKKINNSSGDGSP
FT                   SSPAVVFPPTAVTELQSNIVVDTDSEKTRQPVLLYIAQFRPEKNHPLVLRSFARFLQER
FT                   TNNPAYEGQPPPRLVLIGSVRHSSPDETHIYNLRLLAHELRIRDHTTFLCDASWPVMLS
FT                   HLRTASVGVNAMWNEHFGICVVEYQAAGLICVTHDSGGPREDIVVDLGDGATGFRAETE
FT                   EQFAASFEAALALPEAEKLAMRQRARRSAQRFTEEEFSRKWLDQVQKLVKASTV"
     atggccctct tatcaaacgc cattctggcc actctggtcc tcaccgccac ggctgtcctg        60
     cttccgaagc tgacaggcgt tctcctcggt ctagtgtttc ggggggtggg ctggctgatc       120
     tggcgacgaa ctcggtctcg ccgtgaatat gtgatcgcgc gggcgcgatc tgaagaggag       180
     gagttacgcg cctcacggcc aaagggttca acactatcgc ggaacggtgc cgaagacgag       240
     gactgggaga aggtggatag ttcaggcaca ggcggggtac agactacggc tggtagtgga       300
     agcagtagtg gctctggcaa tgaaagttac gagagtccag aggactggga tggcatcatt       360
     ggattcttcc acccattctg taatgccggc ggaggtggcg aacgagtctt atgggaagcg       420
     atacgcgcaa cacagaagcg ctggccgaag gcaatctgcg ctatctacac gggtgaccat       480
     gaagtcaata aagccacgat gttggagaag gtggagaacc ggttcaacat tcgcctacat       540
     gcgcctaccg tggtgcttct atacctgaca acccgcaagt atgttgttag tagctcatac       600
     ccttacatga cactgctggg acagtcgctg gggtcactga ttgttgccta cgatgctttt       660
     acgttgcttg taccggacgt ttttgttgac accatgggct atgctttcac acttgctctg       720
     tgcaagtggt ttttcccgag aattccagtt ggtgcctatg ttcattaccc gactatatca       780
     accgacatgc tcgcttctct cgacgacaag agcggggtgc aagggatcaa ttccggcgca       840
     gggagagggt ggaaagggaa aaccaagcgt cggtactggg agatatttgc caagctatat       900
     ggctgggtcg gtcgacaggt cgatgtagtt atgtgcaact cgtcctggac ggcagcacac       960
     attcgcacgc tttggggcac cggtaagaaa atcaacaaca gcagcggcga cgggagtcca      1020
     tcatcgccgg cggtggtgtt tcccccaaca gcagtcaccg aactgcaatc aaatattgtc      1080
     gttgacacgg acagcgagaa gactcgccag cctgttctac tttacatcgc acaattccgg      1140
     ccagagaaga accacccgct agtattgcgc tcctttgcgc gattcttaca agaacgaaca      1200
     aacaacccag cctacgaagg tcaaccgcct ccgcgtcttg tactcattgg atccgtgcgc      1260
     cattccagcc ctgatgaaac ccacatctac aacctgcgcc tcctagcgca tgaactccgc      1320
     atccgcgatc atactacatt cttgtgcgac gctagctggc ctgtcatgct gtcacatctc      1380
     cggaccgcct cggttggcgt caatgccatg tggaacgagc acttcggtat ttgcgtcgtg      1440
     gagtaccaag ccgctggtct catctgcgtc acacacgact cgggtggccc acgtgaagac      1500
     attgtcgttg atctggggga tggtgcaact ggattccgag ctgaaacaga agagcagttt      1560
     gctgcttctt tcgaggctgc ccttgctctt ccggaggcag agaaactcgc catgcggcag      1620
     cgggctcgtc gctcagctca acgattcacc gaagaggagt tttcccgcaa gtggctggat      1680
     caagtacaaa agcttgttaa ggcgtcgacg gtttaa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page