(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE298

PENCW_10.PE298       Location/Qualifiers
FT   CDS_pept        685294..686331
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978072"
FT                   /orf_name="Pc13g02980"
FT                   /product="Pc13g02980 protein"
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91367.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI0001830EAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H202"
FT                   /transl_table=1
FT                   /translation="MYALRSSQTIQLTRRAIQLPRSQVRYFHPTRPASFSVVGLALDSS
FT                   TAFIHGVHTVSCLPWVASIPLTAVLIRTFVGLPILLYTRLHRHREMKIVPILSAWMKRY
FT                   AQKQMDQVPTANLRNYNNTEVKRNILTELRKRTAVLHKRWGVSSKYKAIGFLQIPVFIA
FT                   LMESLRGMSGNNSGIIAWLSSFIESSQDPASTAQPLHLTIEPTLANEGALWFPDLLAGD
FT                   PTGVLPLCLTASILGNVLMGWKVKPWKEIALLPKIEMYKQTLFTGLRSFVIVLTCYIGF
FT                   ASFVQGMPTALMLYWITSTNVATLQTWVLDKKVFSPPGFKRFVEKSIAFEKPGVEDPFQ
FT                   LKNLR"
     atgtatgccc tccgctcgtc acagaccata caattaacgc ggcgggccat acaattgcct        60
     cgctcgcaag ttcgatactt ccacccaaca agaccagcct cattctccgt cgtgggcctt       120
     gcactggaca gctccaccgc atttattcac ggcgtccaca ctgtttcatg cctaccatgg       180
     gttgcatcaa ttcctctaac tgccgtactt attcgtacgt ttgtcgggtt gccgatcctg       240
     ttatacactc gactccatcg ccatcgcgaa atgaaaatag tgccaattct aagcgcttgg       300
     atgaagagat atgcgcagaa gcagatggac caggtcccta ctgcgaacct caggaactat       360
     aataatactg aagttaagcg caatatcctc actgaactaa gaaaacgaac agctgtgctt       420
     cataagcgct ggggagtatc cagcaagtac aaagcaatcg gcttcctgca gatccctgtt       480
     tttattgcgc tcatggagag tctgcgcggg atgagcggta acaatagcgg catcattgcc       540
     tggctgtcgt cgtttatcga gtcgtcgcaa gaccctgcct ccacggccca gcctctgcat       600
     ttaaccatcg agcctactct tgcgaacgag ggtgccctct ggttcccaga tttactggca       660
     ggtgacccaa caggcgtgct gccgctttgt ctgactgcgt caatcttggg gaacgttctg       720
     atgggatgga aagtcaagcc ttggaaggag atcgcactcc ttccaaaaat cgagatgtac       780
     aagcagaccc ttttcaccgg tttacggtcc tttgtcatag tattgacatg ctatattggc       840
     ttcgcaagct ttgttcaagg gatgccaact gcgcttatgc tctactggat caccagtacc       900
     aacgttgcta cgctacagac ttgggtactg gacaaaaagg tgttttcacc accagggttc       960
     aagcgttttg tcgagaagtc catcgcgttc gagaagccgg gcgttgagga cccgttccag      1020
     ctgaaaaatt tacgctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page