(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE299

PENCW_10.PE299       Location/Qualifiers
FT   CDS_pept        join(complement(688430..689094),complement(687357..688376),
FT                   complement(687188..687299))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949866"
FT                   /orf_name="Pc13g02990"
FT                   /product="Pc13g02990 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91368.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001830EAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H203"
FT                   /transl_table=1
FT                   /translation="MRQATVQACRTARRAPVWNIAAKRPCPLTFNQLRGIRPYSGGRRS
FT                   SHTPVAPRSSMHRRNLSLAVISTVVASGAWYTCQGDTVKSAATQIRSFASSALNSAYAE
FT                   GPAESTRRALLVSGDQFYTATLSADQPLTKHTDDSDRRVLEMLTPEQATQKLRKNEESY
FT                   LVNRGKGVVRYDVVQVPSNSPIEDDHAEKIVEIPASVSAVSDGEPSSDWMFWGVFDGHS
FT                   GWTTSAKLRNVLISYVARELNTTYKAASADPSLLMPTSEAIDAAIKKGFVRLDNDIVHE
FT                   SFKEVMKSKSRRVAAELLAPALSGSCALLSFYDSQTKDLKVAVTGDSRAVLGRRSPSGK
FT                   WTATALSEDQTGGTPSEMKRLREEHPGEPYVTKNGRILGQLEPSRAFGDAFYKWSRDVQ
FT                   DTIKAKFFGRTPHPMLKTPPYVTAEPIITTTKIDPSKGDFVVMATDGLWEMLSNEEVVG
FT                   LVGHWVEQQQSAAASTGSKAWLQSWFGFDNQKKLPVETAADGSTEGQRRPIRQQQYDIS
FT                   GAASRFVVEDKNAATHLVRNAMGGKDKDMVCALLTLPSPYSRRYRDDVTVEVIFFGQGP
FT                   DSRTVEVNQEASASEQPPKSKL"
     atgcgtcagg cgactgttca ggcctgccgt actgctcggc gtgcaccagt atggaacatt        60
     gccgctaaac ggccgtgccc tttgaccttc aaccagctgc gagggattcg gccttactct       120
     ggtggcagac gctcatccca tactccagta gctcctcgat catccatgca tcgccgcaac       180
     ctctccctcg ccgttatctc gaccgtcgtt gcctccggag catggtatac ttgtcagggt       240
     gacaccgtta aatcggcagc aacccagatc cggagttttg catcgagtgc cctcaactcc       300
     gcctacgcag aagggcccgc cgagtccaca cgacgtgcct tgttggtcag cggcgatcaa       360
     ttctacacag cgacgctctc cgcagaccag cctcttacca agcatacaga cgattcagac       420
     cgccgagtcc tggagatgtt gactcccgag caagcgaccc agaagcttcg caagaacgag       480
     gagtcatatt tggtcaatcg gggaaagggc gttgttcgtt acgatgttgt tcaggttccc       540
     agcaactctc ccattgagga cgaccatgcg gaaaagatag tggagatccc agcatccgtg       600
     tctgctgtca gcgatggcga gccgagcagc gactggatgt tctggggagt ctttgacggt       660
     cactcgggct ggaccacatc tgcgaaattg cgcaatgtgt tgatctcata tgtggctcgt       720
     gaattgaaca caacttacaa ggctgcttct gctgatccat ctctcctcat gccaacatcc       780
     gaggccatcg atgccgccat caagaagggc ttcgtccgcc tcgacaatga catcgtacat       840
     gagagtttca aagaagtcat gaagtctaaa tcacgacggg tggccgccga gctccttgct       900
     cctgctctct ctggatcatg tgctcttctc agcttctatg actcccagac caaggacctc       960
     aaggttgctg ttactggaga ctctcgcgca gttctgggcc gtcgcagccc tagcgggaaa      1020
     tggactgcta ctgcgctttc tgaagatcag actggtggca ccccatcaga aatgaaacgt      1080
     ttgcgtgagg agcaccctgg cgagccatat gtcaccaaga atggtcgaat cctcggccag      1140
     cttgaaccca gccgtgcgtt cggtgacgcc ttctacaagt ggagccggga cgtccaagat      1200
     acaataaaag cgaagttctt tgggcgcact cctcatccta tgctgaagac gcccccttac      1260
     gtcaccgccg agcctatcat tactactacc aagatcgatc cctccaaggg cgattttgtc      1320
     gtcatggcta ctgacggcct gtgggagatg ctgagcaatg aggaagttgt tggcctggtt      1380
     ggtcattggg ttgagcaaca gcaatctgct gctgcaagca caggtagcaa ggcttggtta      1440
     cagagctggt tcgggttcga taaccagaag aaactgcctg tggaaactgc agccgacgga      1500
     tcaaccgaag gccaacggcg tcccatccgc caacagcaat atgatatctc tggtgcggct      1560
     agtcgatttg ttgtcgagga caagaacgca gcaacgcatc ttgtgcggaa cgcaatgggt      1620
     ggaaaggaca aggatatggt gtgtgcgttg ttgacgctac ccagtcccta ctctcgccga      1680
     taccgtgacg atgttaccgt cgaggtcatc ttctttggtc agggccctga ttcccgcaca      1740
     gtcgaagtca accaggaagc gagtgcatca gagcagcctc ccaaatcaaa gctttag         1797
//

If you have problems or comments...

PBIL Back to PBIL home page