(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE3

PENCW_10.PE3         Location/Qualifiers
FT   CDS_pept        join(complement(9423..9470),complement(8974..9371),
FT                   complement(8020..8923),complement(7363..7974))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824328"
FT                   /orf_name="Pc13g00030"
FT                   /product="Pc13g00030 protein"
FT                   /protein_id="CAP91072.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001830C37"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H0"
FT                   /transl_table=1
FT                   /translation="MLETLPCEILMLIADWLPVTTLRVLSRASSRLYAVLVPRIYRTVS
FT                   FCAASEWALNVLDVDPFFRHLGPSRAADYLQHTRHLQIRAPFHLVRFNRCAYYNIFRAA
FT                   GLPESPAPLGASDDATAHQQFLDDVKDQLQLIFTHLEPNRLSIFEWRLGTCVPVGVLDQ
FT                   EGYLSQYQQRLTRLSLVTDGTCPETSHRLEGMSRLTCLTAFEWEGLQHPSEVDLLRRCI
FT                   RQNWSCLDQLSIGFVPSAFARALCWQSLGLQRPELEDGGRGTGVTTNEDTGIANPTALS
FT                   ALSTLSLSKVTLPLDISSGHNAIFYSLRSLTLRDCPNQLHLVQLLSWSQKPLRLTHFEF
FT                   SFDYLLHEPGEGCGLSAVVRFLCSFRGLQHLHLRLSNFPSSKSHIQDTIQHHQTTLKSL
FT                   VYHERQLAPIDADGLFEDDRDVSPAWVTNLSTGVDLGQVCALALCASPSAARRCLRPTA
FT                   KHSQLQILHLRFSGLERFHRDIPREITTYLNGIRKGYSWHPRSCWSSVNRDVSNDSHNY
FT                   PPIVDEYFDRSPLEFVDSQEAVLMSSAAIAEAEDFVSFADWAFGPDGLPALQVLAFGDF
FT                   SHGDRYRSQQFLMRRVYPSSEGGGKELAGLACDDTTRLPFCSADMSDPSIWDGAMVDGA
FT                   RFLSACPGGGLMESPYEL"
     atgctggaga ccttgccgtg tgagattctg atgctgattg cagattggct gccagttacc        60
     actctgcgcg ttctcagccg cgcctcgtcc agattgtatg cagtgttggt tcctcggata       120
     taccgtacag tttcattctg tgcagcaagt gaatgggcac tgaatgtgtt ggatgtcgac       180
     cccttctttc gccatctcgg tccttcccga gccgcggact atctccagca cacgcggcac       240
     ctacagatca gggctccatt ccatcttgtt cggtttaatc gatgtgcata ctacaacatc       300
     tttcgtgccg cggggctgcc agagtccccg gccccgctgg gagcatcgga tgatgcgacg       360
     gcacatcagc aattcctgga cgacgtgaag gatcaattgc agctgatttt cacccacttg       420
     gagccgaata gactgagcat atttgaatgg cgactgggga catgtgttcc agtgggggtt       480
     ctcgaccagg aaggctatct cagtcagtac caacagcgcc tcactcgtct ctcactcgtc       540
     actgatggga cctgccctga aacgtcgcac cgcttggaag gaatgtccag actaacctgt       600
     ctgacggcgt ttgagtggga aggactccaa catccgtccg aggttgattt gttgcgacgg       660
     tgcatccgtc agaactggag ctgcctagat caactgtcca tcggcttcgt tccatcggct       720
     tttgcccgtg ctctgtgctg gcagagcctt gggcttcagc gaccggagct tgaggatggg       780
     ggtagaggga ccggcgtcac tacgaacgag gatacgggga ttgcgaatcc cacagctctt       840
     tccgctctgt ccacgctgtc attgtcaaag gtgaccttgc ccctggatat ctcatcggga       900
     cacaatgcga tattctactc tctgcggtcg cttacgctgc gtgactgccc taatcagttg       960
     catctcgtgc aattactgtc ttggtcacag aagccgctcc gactgacgca tttcgaattc      1020
     tctttcgatt atctgctgca cgaaccgggc gaaggatgtg gcctttctgc tgttgtgcgg      1080
     ttcttatgtt catttcgtgg gctgcagcat ctgcatttga ggttgtccaa tttcccatcg      1140
     tcaaaatccc acatccagga caccatccaa caccaccaga ccacgttgaa aagccttgtc      1200
     taccatgagc gccaactcgc accaatcgat gctgatggct tatttgagga tgatcgggat      1260
     gtgtcgcccg cttgggttac gaatttgtct accggtgtag acctgggcca ggtgtgtgct      1320
     ctggctttgt gtgctagtcc gtctgcggct cgtcggtgcc ttcgacctac tgccaagcat      1380
     tcccagcttc agattctaca tctgcggttc agcggcctcg agcgattcca tcgagatatc      1440
     ccacgagaga ttaccactta tctaaatggg atacgcaaag gatattcatg gcatcctcgt      1500
     tcgtgctgga gttccgtgaa ccgggacgtc tccaatgata gccacaacta ccctcccatt      1560
     gttgatgagt actttgacag gtcacccctc gagtttgtag actcgcagga ggcagtgctt      1620
     atgtcttctg cggcaattgc agaggctgag gatttcgtgt catttgcgga ctgggcattt      1680
     ggccccgacg gactgccagc cctgcaggtt ctcgcgtttg gggacttctc tcacggtgat      1740
     cgatacagga gccagcagtt tctaatgcgt cgtgtctatc cttcatcgga gggcggtggc      1800
     aaggaacttg ccggccttgc atgcgatgat acgacgcggc tgcccttttg ttcagcagat      1860
     atgagtgacc cttcgatttg ggatggtgct atggtggacg gggctcgttt tctgtccgca      1920
     tgcccagggg gtgggttaat ggagtcaccg tacgagttgt ag                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page