(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE300

PENCW_10.PE300       Location/Qualifiers
FT   CDS_pept        join(689376..689872,689984..691544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672176"
FT                   /orf_name="Pc13g03000"
FT                   /product="Pc13g03000 protein"
FT                   /protein_id="CAP91369.1"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniParc:UPI0001830EAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H204"
FT                   /transl_table=1
FT                   /translation="MSSRAIRKLQKLREQAQQRESDQQDESSEDEAPRPAKPKFNAFDL
FT                   LNAENEDEEEDEDEAQEEPYARIPEPEPEPTPVKPKKSNKKKKKKAVKTSDPASTPPSK
FT                   SNEADLDEIDRALKDLSTGGPTSVGTGLSTRHPPEASFPKTTSELLGIEPKFLNATNEM
FT                   RRLYSPASRGQSLAGVTLRRNILMQGKDEWPRAPSGGLGMETVKKLPSGETLYRLVHNT
FT                   AYQDVQRQFDLCVESMDPQRLIGHLQYNPYHISTLLQVSEIAKHQGDHAVSADLMERAL
FT                   FNIGRSVHSSFANRLKEGEARLDFIHAENREFWLVGWRYITNLAMKGTWRTAYEWAKLL
FT                   LSLDDSDPYCMRLLIDHLALRGREYAQFVQLCTQTRFSRDWANLPNIQCSLVMAYLRLN
FT                   KPQECRRQLQLAMSHYPWIFSRLAQELDVQHVPKQIWGKMPPTGAHELLTELYIARAKD
FT                   LWNTPEAISLIMEVADSISGEEPNEPPEITLDIARHVVLSDIAKVTTHLPNHFVAGRLS
FT                   SSDPLPPYESEAYQQQSEPTPIYAAPAGGGENWLQDLLGQINHNVRPRNVESDDGEPIG
FT                   FEDEDEDEDTEHIDIPHSRPPLRDPAALEGWLTREGLQTLRIFLTQYGVDRGNWSEVVV
FT                   DYAPLTNYLEAMAAISETARQRLLDGSIKDSLGDFAVSMLEDELAIMRGE"
     atgtcatcac gagcaattcg aaaactgcag aagctgcgtg aacaagcgca gcagcgagaa        60
     tccgaccagc aagatgagtc aagcgaagac gaagccccgc gccccgcgaa accgaagttc       120
     aatgcctttg atttgctgaa cgctgaaaat gaggatgagg aggaagacga agatgaggcc       180
     caggaggaac cttacgcacg cataccagag ccagagcctg aaccaacccc ggtaaagccc       240
     aaaaagagca acaagaaaaa gaagaagaag gcagtcaaaa cctccgatcc ggccagtacc       300
     ccgccttcaa aatcgaatga agcagaccta gatgaaattg atcgggcgtt gaaagatcta       360
     tcgacaggtg ggcccacgtc agttggcaca ggtttatcta ccagacaccc tcccgaggcc       420
     tcttttccaa agactacgag cgaattgctc gggatcgaac ccaaatttct caacgcaacg       480
     aatgagatgc gcagactgta cagtccagcc agccgaggtc aaagtctggc tggagttaca       540
     ttgcgacgca atatccttat gcagggcaaa gatgagtggc ctcgtgctcc gagcggaggg       600
     ctaggcatgg agactgtgaa gaagcttcct tccggggaga ctctctaccg actagtacac       660
     aatactgcct atcaagatgt acagcggcag ttcgatctct gtgttgaatc gatggaccca       720
     cagagactca tcgggcacct ccaatacaac ccgtatcata tttctacgct tctccaagtg       780
     tcggagattg ccaaacacca aggcgatcat gctgtgtctg ccgatctgat ggaaagagcc       840
     ctattcaata ttggacgctc agtgcactct tcgtttgcca atcgcctcaa ggaaggcgag       900
     gccagacttg atttcataca tgcggagaat cgagagttct ggctagttgg gtggaggtac       960
     attaccaacc tagcaatgaa gggcacttgg agaaccgctt atgaatgggc taagctcttg      1020
     ctcagtctgg atgacagtga tccttactgc atgagactgc tcatcgacca cctcgcgctg      1080
     cgaggtagag aatacgcaca attcgtgcag ctctgtaccc agacacgctt tagtcgcgac      1140
     tgggctaacc ttcctaatat tcaatgctcg ctggtaatgg catatctccg gttaaacaag      1200
     ccccaagaat gtcgccgaca gctgcagctt gccatgtctc actacccgtg gattttcagc      1260
     aggctagcac aggaacttga tgtccagcac gttcctaagc aaatctgggg caagatgcct      1320
     cctacaggcg ctcatgagct gcttaccgaa ctctatatcg cccgcgcaaa ggatctttgg      1380
     aatacccccg aggctatttc tctcattatg gaagtcgcag attctatttc tggcgaggag      1440
     cctaatgaac caccagagat cactttggac atcgctcgtc atgtggtttt gtccgatata      1500
     gctaaagtga caacccatct tcccaatcac tttgtggctg gtcgactgtc ctcctccgac      1560
     cctcttccgc cctatgaatc cgaagcgtac cagcaacaat ctgaacctac gcccatctat      1620
     gcagcccctg ctgggggcgg cgagaattgg ctgcaggatc tcctcggcca gatcaaccac      1680
     aacgtccgcc ctcgcaatgt cgaatccgac gacggagagc caattggatt tgaggatgaa      1740
     gatgaggatg aggatacaga acatattgat atcccacact cgcgcccacc actcagagat      1800
     ccggcagccc ttgaggggtg gctcacgcgc gaggggttgc agactctccg tattttcctt      1860
     actcaatacg gagtcgatag aggcaactgg agcgaagtgg ttgtggacta tgcacccttg      1920
     accaattatc tggaggccat ggcggcaatc tcagaaacag cccgtcaacg attgttggac      1980
     ggtagtatca aggactctct tggggatttt gcggtcagca tgctcgagga tgaactcgcg      2040
     attatgcggg gagaataa                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page