(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE302

PENCW_10.PE302       Location/Qualifiers
FT   CDS_pept        join(693212..693575,693660..693940,693994..694164,
FT                   694221..694535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949867"
FT                   /orf_name="Pc13g03020"
FT                   /product="Pc13g03020 protein"
FT                   /protein_id="CAP91371.1"
FT                   /db_xref="UniParc:UPI0001830F6F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H206"
FT                   /transl_table=1
FT                   /translation="MASKRPRSDSPEASFSRPRRKVTEPDPPPPVPYEDSIFSVQTDVS
FT                   EFTRAANLTAMLDRIDRYTTSAERPHDEILQASLRNFLEMLPPDGCAELLKDIDSKPGD
FT                   EGLYEVFSNLYTGLRCRMMSRSKPPSITPFPNPKRGDNAEALSAKMDKPISRDRKFKTA
FT                   LLARDGYKCAVTGHFDQGRYEELGLDSPDLNPTDTQGAHIIPFSYGFWNSSQSPPPDMA
FT                   TAWEVLYRCFPALRRLRFNWEDINNLENGITMAEWIHSRFGKFRLAFEATEVPDQYDVE
FT                   IFGPIGNAYRNMIHDRITFTNHDSAKDHKLPSSILLECHYILAKILNASGMAEAFDHDF
FT                   DRWEAVKESVHSLREDGKTDIGSILGLSFLCDDIAR"
     atggcgagca aacgccctcg ttcggattcc ccagaggcat ccttttctcg cccccgccgc        60
     aaggtcacgg agccagaccc gcctccccca gtcccgtatg aggattcaat cttctcggtc       120
     caaacagatg tgtcggaatt cacgcgtgca gcaaatctaa ccgcaatgct tgatcgtatt       180
     gatcggtaca ccacaagtgc ggaaagaccc cacgatgaaa tcctccaagc atcccttaga       240
     aatttcctcg agatgttgcc accagatgga tgcgccgagc tcttgaagga catcgatagc       300
     aagccgggag acgaaggcct atatgaggtt ttcagtaacc tgtacaccgg cctgagatgc       360
     cggatgatgt cgcgctcaaa gcctccctcc attaccccat ttccgaaccc aaagcggggc       420
     gataatgccg aagcacttag cgcgaagatg gataagccaa tcagccgcga ccgaaagttc       480
     aaaacagcct tgctagcgag agatggatac aagtgtgccg tgactggtca ttttgaccaa       540
     ggccgatatg aagaacttgg tttggattcg cccgatctta atcctacgga tacacaaggg       600
     gctcatataa ttcccttctc atatggattt tggaattcaa gccagagccc acctcccgat       660
     atggctactg cttgggaagt tttgtaccgg tgctttccag cactccgacg cctaagattc       720
     aactgggaag atatcaacaa ccttgagaat ggaatcacca tggctgaatg gattcattca       780
     aggtttggaa aatttcgcct tgcttttgaa gcaacggaag tccccgatca atatgatgtt       840
     gagatatttg gaccgatcgg caatgcgtat cgcaatatga ttcacgatcg gatcactttc       900
     acaaaccacg actcagcaaa ggaccataag cttcccagtt caatcctact ggagtgccat       960
     tacattctag caaaaattct taatgcttcc ggtatggctg aggcattcga tcatgatttt      1020
     gatagatggg aggccgtaaa ggaatcagtc catagcctcc gcgaagacgg gaagacggat      1080
     attggcagta tcttaggatt atcatttttg tgcgatgata ttgctagata g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page