(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE303

PENCW_10.PE303       Location/Qualifiers
FT   CDS_pept        join(695704..695790,695843..696441,696494..696543,
FT                   696595..696653,696712..696861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949868"
FT                   /orf_name="Pc13g03030"
FT                   /product="Pc13g03030 protein"
FT                   /protein_id="CAP91372.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0001830F70"
FT                   /db_xref="UniProtKB/TrEMBL:B6H207"
FT                   /transl_table=1
FT                   /translation="MEGPIPLTAREAASGLLGSVSMTCWFFLLVPQLIENYRNGNAEAI
FT                   SLLFVFVWFIGDVANLAGGLLSRLVPVIIAIAVYFCIADGVLIAQCVYYKVRNSRPEPF
FT                   HRRRSSTETPDPTTPLLGRRFSDSLASSQSRRRSSGSLRRYHAGRRESEVEGTLAKIVE
FT                   ENDYGRKAWVKNFASVVGIFLIGMAGWTIAWQTGMWVPAPLENNNGSEEATGGLVLGYF
FT                   SAACYLGARLPQIYKNYSEKSCEGLSLLFFILSLLGNLTYGAGILCHSTEKEYFLTNLP
FT                   WLIGSLGTMVEDAVIFFQFRIYAIQEPRLSAIS"
     atggaaggcc ctataccttt gacagcccgt gaggctgcat ctggtctctt aggctcagta        60
     tctatgacat gctggttttt tcttttggta cctcaactaa ttgagaacta ccgcaatggc       120
     aatgcagaag ccatatctct tctcttcgtc tttgtctggt tcatcggcga tgttgcaaac       180
     ctcgccggcg gcttactatc ccggctcgtg cccgtaataa tcgcgatcgc ggtatacttc       240
     tgcatcgcag acggcgtgct gatcgcgcag tgcgtgtact ataaagtgcg caactcgcgt       300
     cccgagcctt tccaccgccg acgctcgtcc accgagaccc cggacccgac taccccgttg       360
     ctggggcggc gattcagtga ctccctcgca tcttcccagt cgcggcgccg gtcgtcgggc       420
     tcattacgcc gttaccatgc cggccggcgc gagagcgagg tcgagggtac cctggccaag       480
     atcgtcgagg agaatgatta tggccgtaag gcgtgggtta agaattttgc tagtgtggtt       540
     gggatcttcc tcattggtat ggcgggttgg accatagctt ggcagacggg gatgtgggtg       600
     ccggcgccat tggagaataa taatggttct gaggaggcta ccggagggtt agtgctgggg       660
     tatttcagtg ctgcgtgcta tctgggtgcg agattgcctc aaatctacaa aaactacagc       720
     gagaagtcat gcgaaggatt gtcgctcttg ttctttattc tctctcttct aggaaacttg       780
     acctatggcg cagggattct ttgccactct acagagaaag aatatttcct caccaatctt       840
     ccatggttaa ttggatcgct gggaactatg gttgaggacg cggtcatctt cttccagttc       900
     cggatctatg ctatccagga gcctcgtctc tcggcgatct cctaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page