(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE304

PENCW_10.PE304       Location/Qualifiers
FT   CDS_pept        join(complement(697595..697641),complement(697470..697544),
FT                   complement(697184..697319),complement(697084..697158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949869"
FT                   /orf_name="Pc13g03040"
FT                   /product="Putative uncharacterized protein Pc13g03040 "
FT                   /protein_id="CAP91373.1"
FT                   /db_xref="UniParc:UPI0001830F71"
FT                   /db_xref="UniProtKB/TrEMBL:B6H208"
FT                   /transl_table=1
FT                   /translation="METGCSVYLRVITWPRILGELKTFGTLLGLSMIKVLLWPGDAVGL
FT                   VVGGSLIRCFRSQGDLSLSAPGPYGYRSVDWSSRGLINGAKNCTDNISDVYCCSFQGYA
FT                   VATPLL"
     atggagactg ggtgctcggt gtacctccgt gtcataacgt ggccgaggat tttaggggaa        60
     ttgaagacgt ttggcacact tcttggtctg tccatgatca aagttttgct ttggcctggc       120
     gatgctgtag ggctggtcgt gggtggatct ctgatccgat gtttccgatc tcaaggtgat       180
     ctttcattga gcgcaccagg cccctacggt tatcgctcag tagactggag ttctcgaggc       240
     ctcatcaacg gtgcgaagaa ctgcaccgat aatatcagtg atgtgtactg ctgttcattc       300
     caaggttacg ctgtcgcaac acccctacta tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page