(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE305

PENCW_10.PE305       Location/Qualifiers
FT   CDS_pept        join(complement(698432..698500),complement(698177..698254),
FT                   complement(697943..698072),complement(697839..697885))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949870"
FT                   /orf_name="Pc13g03050"
FT                   /product="Pc13g03050 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91374.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI0001830F72"
FT                   /db_xref="UniProtKB/TrEMBL:B6H209"
FT                   /transl_table=1
FT                   /translation="MSTAELACSYAALILADDGIEVSADKIQTLISAAKVQEVEPIWSS
FT                   IFARALEGKDIKELLTNVGSAGPAAAAPAGGAAAEAPAEAKAEEKVEEKEESDEDMGFG
FT                   LFD"
     atgtctaccg ccgagctcgc ctgctcttac gccgccctca tcctggccga tgacggtatt        60
     gaggtctccg ccgacaagat ccagaccctc atctctgccg ctaaggtcca ggaggttgag       120
     cccatctggt cttccatctt cgcccgggcc ctcgagggta aggacatcaa ggagctcctg       180
     accaacgtcg gctccgctgg ccccgctgcc gctgcccccg ctggtggcgc cgctgctgag       240
     gcccccgccg aggccaaggc tgaggagaag gttgaggaga aggaggagtc cgatgaggac       300
     atgggcttcg gtctcttcga ctaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page