(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE307

PENCW_10.PE307       Location/Qualifiers
FT   CDS_pept        join(complement(702043..702206),complement(701288..701852))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949871"
FT                   /orf_name="Pc13g03070"
FT                   /product="Pc13g03070 protein"
FT                   /protein_id="CAP91376.1"
FT                   /db_xref="UniParc:UPI0001830F74"
FT                   /db_xref="UniProtKB/TrEMBL:B6H211"
FT                   /transl_table=1
FT                   /translation="MGSHNTSMKLPSSAKSDNNRATKFQQTPPTYEASTQNVMEKYKKQ
FT                   VQHAKTPENLIQAGLVRRTYLDITLRWIVQRRAWCEQKAKALQIRQRDMSSQDLSRLEA
FT                   YEEQIKSLSSRYWVAHRKQWIESDKLWSPSAKRALTRQRKHKDWYLSGVLREDCANRGG
FT                   CCGRSCGCCERTRMTKVNTDRVHDRGHCTTACSCCLEAHGIDGEHLDMKGVDEVHFSRD
FT                   RDPHTMRLFRGYIFYLNGME"
     atgggcagcc acaacaccag tatgaagctt cccagctctg cgaagtctga taataacaga        60
     gccaccaagt tccaacaaac accgccaaca tacgaagcga gtacccagaa tgtgatggaa       120
     aagtacaaaa agcaagtgca acatgccaag actcctgaga acctgattca agcgggactg       180
     gttcgaagga cttatctcga catcacccta cgatggattg ttcaacgcag agcatggtgc       240
     gagcaaaagg ctaaagccct acagatacgt caaagggata tgtcgtccca agatttgtct       300
     cggctcgaag cttatgaaga acaaatcaaa tccctcagct ctagatactg ggttgcgcat       360
     aggaaacaat ggatcgagtc ggacaagtta tggagccctt cggcgaaacg ggctctaaca       420
     aggcagagaa agcacaagga ttggtatctc tccggtgtgc ttcgtgaaga ctgtgcaaac       480
     cgagggggct gttgcggacg cagctgtgga tgttgcgaga ggacgcgaat gaccaaggtc       540
     aatacagata gggtccatga tcgaggtcac tgtactacag catgcagttg ctgtctcgag       600
     gctcatggga ttgacggcga acatctggat atgaaaggcg tggatgaagt tcacttcagt       660
     cgcgatcgcg atccccacac tatgcgactg ttccgggggt atatcttcta tttgaacggg       720
     atggaatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page