(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE308

PENCW_10.PE308       Location/Qualifiers
FT   CDS_pept        complement(702486..703322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949872"
FT                   /orf_name="Pc13g03080"
FT                   /product="Putative uncharacterized protein Pc13g03080 "
FT                   /protein_id="CAP91377.1"
FT                   /db_xref="UniParc:UPI0001830F75"
FT                   /db_xref="UniProtKB/TrEMBL:B6H212"
FT                   /transl_table=1
FT                   /translation="MQPSERLPSYEETTKVSKALVNEFISGLEAEQSRNSFLIVLLNRR
FT                   LGIDDKCKAIEDAHRIPAIEQDTDAESVEDWLRLRGMHKLAQSVCYYVHTRHSSSNRRW
FT                   CKALIEADIEIRWIVQRMIWVHQQKRNMGPQALDGYLKSLKQKYWRVHRKLWIAEDSIS
FT                   SRSAARAFAFQRQKIDWYLSSELREDCARGGGCCGRACGCCEIPRTIDELRTEGIRNRG
FT                   HCTSACSCCLDAHELDGKNIGDETTDLQGLRFDTTFTEWLPDPHTLRLLKGYVFSI"
     atgcagccct cggaaaggct cccaagttat gaagaaacca cgaaagtgtc gaaggccttg        60
     gtgaacgagt tcattagtgg acttgaagca gaacaaagtc gcaacagctt tctaatcgtc       120
     ttgttaaaca gaagactagg catcgacgac aaatgcaaag ctatagaaga tgcacatcga       180
     ataccagcta ttgaacaaga cacggatgcc gaatcggttg aagactggct tcggcttcgg       240
     ggcatgcata agcttgctca atcggtgtgc tattatgttc acactagaca ctcttcttct       300
     aacagacgtt ggtgcaaagc actgattgag gctgatattg agatacgctg gattgtccaa       360
     cgaatgatct gggttcatca acagaaacga aacatgggtc ctcaggcctt ggacggatac       420
     ctcaaatcgc tgaagcaaaa gtactggaga gtccatcgga aactatggat cgcagaagac       480
     agtatttcca gtagatctgc agcgcgagca ttcgcatttc aaagacagaa gatcgactgg       540
     tatctctctt ctgaattacg cgaagattgc gctaggggag gaggttgctg tgggcgggca       600
     tgcggatgtt gcgaaatacc acgaacgatc gatgagcttc gaacagaagg gattcgtaac       660
     cgaggtcact gcacttcagc atgctcttgt tgtctggatg cccacgagct tgatggcaaa       720
     aatatcggag atgagaccac agatctacaa ggtcttcgct tcgatactac cttcactgaa       780
     tggctcccag acccccacac cttgcgttta ctcaaaggtt atgtcttttc tatctaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page