(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE309

PENCW_10.PE309       Location/Qualifiers
FT   CDS_pept        complement(704067..704969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978073"
FT                   /orf_name="Pc13g03090"
FT                   /product="Pc13g03090 protein"
FT                   /protein_id="CAP91378.1"
FT                   /db_xref="UniParc:UPI0001830F76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H213"
FT                   /transl_table=1
FT                   /translation="MQASEKLPTYEESTKSPKEILMDRLKKKIEKAQKPEDLLTHLLST
FT                   DLNVEDKATLLRQAPKRIYACYHRRSAEYVEAQLREAGYGGLALYLYWCFFWYEAQPTV
FT                   PESWIKELIELDIEERWVAQRKVCIQEKLQTLQASSERPLSFEDGAKHASQLESYEEQL
FT                   KDLNKRHWALSRKKWNNRTSITSWSFSRAYDIQRSYPQWYLSFDLISDCVGRGGCCGRS
FT                   CGCCKNSRTVGGLDDGINTRGHCTTACGCCLKAHGIEDLDVGINEEIPDLRELCFEYRS
FT                   PPLMSSHSRQLLRGYAFNI"
     atgcaagcct cagagaaact tccgacttac gaagagagca caaagtctcc caaggaaatc        60
     ttgatggata ggctgaagaa gaaaatagaa aaagcccaga aacccgagga tcttcttacc       120
     cacctgcttt caaccgactt gaatgttgaa gacaaagcaa ctctcctgag acaagccccg       180
     aagcgtatat atgcctgcta tcaccgaaga agtgccgagt atgttgaagc tcagcttaga       240
     gaggcaggct acggtgggct tgccctatac ctatactggt gtttcttctg gtatgaggca       300
     cagccgacgg tgccagaaag ctggataaag gaactgattg aacttgatat cgaggaacgt       360
     tgggttgctc aacgcaaggt ctgcattcaa gaaaagctcc aaaccttgca agcctcatca       420
     gagcgacctc tgtctttcga agatggagcg aaacatgcat cgcaactcga gagttatgaa       480
     gagcagctca aagacctcaa taaaaggcat tgggcccttt cgaggaagaa gtggaacaac       540
     aggacatcta taacgagctg gtcgtttagc cgagcatatg atatacaaag atcatatcca       600
     caatggtatc tctcctttga tctaatcagc gattgcgttg gacgaggcgg ctgttgcggg       660
     aggagttgcg gctgctgtaa gaactcgcgg acggtcggtg gattagatga tggtatcaac       720
     acacgaggtc attgtaccac agcctgcggt tgctgtctga aggctcatgg gattgaagat       780
     ttggatgtcg gaatcaacga agagatacca gacttgcgag agctttgttt tgagtacaga       840
     agtccccctt tgatgagttc tcatagccga cagctgctga ggggttatgc cttcaatatc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page