(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE310

PENCW_10.PE310       Location/Qualifiers
FT   CDS_pept        join(complement(706469..706893),complement(706267..706404),
FT                   complement(706028..706201),complement(705872..705897),
FT                   complement(705651..705760))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129245"
FT                   /orf_name="Pc13g03100"
FT                   /product="Pc13g03100 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91379.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI0001830F77"
FT                   /db_xref="UniProtKB/TrEMBL:B6H214"
FT                   /transl_table=1
FT                   /translation="KIKKILPLEYYNLAKVFLKKKLDKLPLYRPSIDXNIVLKAKVXLD
FT                   YYPLYKLSFNKLKAAKXYIIKNLDKGFIILNASLYISLILIVKKPSSRLRFYIDFRKLN
FT                   IITKKDYYLLPLINKVLXQTSKAKYFTKFNIRXSFYRIYLILGAEDLTTFRIXYRSFKY
FT                   KVILFRLINGLAIFXRFINNILXEYIDKYVVTFIDNILIYSKTLKEYHRXVREVLSYLX
FT                   KASLXVTLLKYKFTIIKTKFLRFIVSIDSIAVNLKKSGXSSYRRPYRXXKAYNPFLDSI
FT                   TSIDDLSKDIVXFXSLYIIXFNRTSYINSLPIIKXPLYSXRRSXLLYXYSIIITXYKKX
FT                   EXKLILXIVYXEXYYLSTIKITISSIXXLSIXKLYKLXSXTIKYRIRNSLLLSIYYRNR
FT                   DXSLRVLYNKIVSRFLXTINLXNTLXLSNKXTNNKRDKASSFYNSISXLNTNXERKILL
FT                   XIYYXERSYLISIIVGSX"
     atgtcacggt cataccatca ctcgaccaat acaaacctcc gtgacgaaaa tggtttctgt        60
     ggtcttcatg gctaccaacc atgcagttgt gcgatgctct acatgacgcc cacggtctat       120
     tctcaacaca gcaaccatat aaaccagtcc tcgacgtacc acgatctaat ccccgctcca       180
     tgttttgacc tgaattgttg tcaatcggat cgttcaactc aagctccaat cttcatcggc       240
     tcccgaaacc cgccagacga tgggtacgat gccaaacaca cttccatgga caacacgtcc       300
     aatgcattta ctggtgtctc ttctccacaa atgcaagtga gcacacctcc aagcaacata       360
     gaccctgctc ttctagaggg acggacagtc tactacgaga agctggctca atcacacacc       420
     ccagaggatc ctcaagttcc tttacggtgc tactggggag gtctcacctg tgaacatggg       480
     ttggtgtttc ccgacatcga atcgctgatg aaccatgtgg aaatgagcca catcaatcct       540
     caactacagg caaatgagca gtctggcgat gtcggtgggc ttaaatgcag ctggaaggag       600
     tgtacttctg ccttcagagc aaagggatct ttgtcacgtc acgttagatg tctacatgtc       660
     aacccgtcct cgtttctttg ccccttttgt ggcaaggggt gcaaccgtga agacaacttg       720
     gaggaccatt tgagcaaagt gaacgggata catgatacac aagtattgga acaaatatcc       780
     cgccaagccc ctcttgcata ctccgtacag ttgagaggaa ccattactta ttccgattgc       840
     ctacccgtca tatatttggg agcaaggctg taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page