(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE311

PENCW_10.PE311       Location/Qualifiers
FT   CDS_pept        join(708277..708321,708371..710722)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949873"
FT                   /orf_name="Pc13g03110"
FT                   /product="Pc13g03110 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAP91380.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI0001830F78"
FT                   /db_xref="UniProtKB/TrEMBL:B6H215"
FT                   /transl_table=1
FT                   /translation="MVSQLVWQRVSASRGMATRLSSQRLLARGLATEASSSRMPPYPKL
FT                   VRNLEQVRRVLGSDRALTLAEKILYAHLDNAEESLLTGTNNGRDVRGKANLKLKPDRVA
FT                   MQDASAQMALLQFMSCGLPSTAVPASIHCDHMIVGERGADTDLPASIKGNSEVFDFLES
FT                   AAKRYGIEFWPPGAGIIHQSVLENYAAPGLMMLGTDSHTPNGGGLGAIAIGVGGADAVD
FT                   ALVDAPWELKAPKILGVRLEGKLSGWASPKDIILSLAGKLTVRGGTGSIIEYHGPGVET
FT                   LSCTGMATCCNMGAEVGATTSVFPFSPSMVPYLQSTHRGHVADAAAEVAAAGPSSLLRA
FT                   DTKAEYDQLVTINLSELEPHINGPFTPDFSVPLSKFADTVREKKWPETFGAGLIGSCTN
FT                   SSYEDMTRAEDLVKQATAAGLKPKADFFITPGSEQIRATLDRDQTLNTFSEAGGVVLAN
FT                   ACGPCIGQWKRTDGVPKDEDNAIFTSYNRNFPGRNDGNRRTMNFLASPELVTALAYSGS
FT                   TTFNPMTDSLTTPDGSTFKFQPPSGFDLPSAGFEEGNPNFLPTAAVPDASAEVIVSPTS
FT                   DRLAILEPFEPFPKGDLSGLQVLYKVKGQCTTDTISAAGPWLKYKGHLPNISANTLIGA
FT                   VNAATGETNVAYDEAGNKYGIPELAEAWKERGISWLVVAEDNYGEGSAREHAALQPRYL
FT                   GGRVIVSKSFARIHETNLKKQGVVPLTFANREDYDRIDACDKVDTVGLYDVLQAGGQGE
FT                   IKLRVTKQKTGEVFDVPVQHTFSQDQCAFILAGSALNLLAKKAHS"
     atggtgagcc agctagtttg gcagcgggtt tctgcctctc gtggcatggc cacacggctc        60
     tcctcacaac ggctcttagc ccgtggccta gccaccgagg cctcctcctc ccgcatgccc       120
     ccatatccca agctcgtccg caacctcgaa caggtccgcc gagtccttgg ttccgaccgc       180
     gccctcaccc tcgccgagaa gatcctttac gcccatctgg acaatgccga ggagtcattg       240
     ctcaccggga ccaacaacgg ccgcgatgtt cgaggcaagg ccaacttgaa gctgaagccc       300
     gatcgtgtcg ccatgcagga cgcttcggcc cagatggctc tgctccaatt tatgtcctgt       360
     ggtcttccct ccaccgccgt cccggctagt atccactgcg accatatgat cgtcggtgag       420
     cgcggtgccg ataccgatct gccggcttca attaagggta acagtgaggt gttcgacttc       480
     ctagagagtg ctgccaagcg ttacggtatt gagttctggc ctcctggtgc tggtatcatc       540
     caccagagcg tgctggagaa ctacgccgcc cctggattga tgatgctcgg tacagacagc       600
     cacactccta acggaggtgg tcttggtgct attgctatcg gtgtcggtgg tgccgacgct       660
     gtggatgcgc ttgtcgacgc tccttgggag ctgaaggccc ctaagattct cggtgttcgc       720
     ctcgagggca agctcagcgg atgggcttcg cctaaggata tcatcctatc cctggctggc       780
     aagctgactg tccgtggtgg cactggctct atcattgagt atcacggtcc tggtgtcgag       840
     actttgagct gcactggtat ggctacctgc tgtaacatgg gtgctgaggt gggtgctacc       900
     acctcggtct tccccttctc gcctagtatg gttccctacc tgcagtcgac ccaccgcggt       960
     cacgtcgccg atgctgctgc tgaggttgcc gccgctggcc cctcgagctt gctgcgcgcc      1020
     gacaccaagg ctgagtatga ccagctggtt actatcaacc tgtccgagct cgagccgcac      1080
     atcaacggac ccttcacccc ggacttctcg gtaccgctgt ctaagttcgc cgacaccgtt      1140
     cgtgagaaga agtggcccga gaccttcggc gccggcctca tcggtagctg caccaactcc      1200
     tcgtacgaag acatgacccg cgccgaggat ctcgtcaagc aggccaccgc agcaggcctt      1260
     aagcccaagg cggatttctt tatcactccc ggtagtgaac agatccgcgc caccctcgac      1320
     cgcgatcaaa ccctaaacac cttctccgaa gccggcggcg tcgtcctcgc caacgcctgc      1380
     ggtccctgta tcggccaatg gaagcgcacc gacggcgtcc ctaaggacga agacaacgct      1440
     atcttcacct cctacaaccg caacttcccc ggccgtaacg acggcaaccg gcgaacaatg      1500
     aacttcctcg cctcaccgga actcgtcacc gcgctcgcct actccggcag cacaaccttc      1560
     aaccctatga ccgactccct gaccacacca gacggctcga ccttcaagtt ccagccccct      1620
     agcggcttcg atcttcccag cgccggcttc gaagaaggta accccaactt cctccccaca      1680
     gccgccgtcc cagacgcaag cgccgaagtc attgtctccc cgacatccga ccgcctcgcc      1740
     atcctcgaac ccttcgagcc tttccctaag ggcgatctct ccggtctgca agtcctctac      1800
     aaagtcaagg gccagtgcac gaccgacacc atctccgccg caggcccatg gctgaaatac      1860
     aagggccacc tgcccaacat ctccgcgaac acactgatcg gcgccgtcaa cgccgcaacc      1920
     ggcgagacga acgtcgccta cgacgaagcg ggcaacaagt acggcatccc cgaactcgcg      1980
     gaggcatgga aggagcgcgg aatctcgtgg ctcgtcgttg cggaggataa ctacggcgag      2040
     ggatctgcgc gcgagcacgc cgcgctgcag ccgcgctacc tcggcggccg ggttattgtt      2100
     tctaagagct ttgcccgtat ccacgagacc aaccttaaga agcagggtgt tgtgcctctt      2160
     acatttgcga accgcgagga ctatgaccgt atcgatgctt gtgataaggt tgatactgtt      2220
     ggtctttatg atgtgctgca ggctggtgga cagggtgaga tcaagctgcg tgttactaag      2280
     cagaagactg gggaggtgtt tgatgttcct gttcagcaca ctttcagtca ggaccagtgt      2340
     gctttcatcc ttgctggtag tgctctgaac ttgttggcta agaaggctca ctcttga         2397
//

If you have problems or comments...

PBIL Back to PBIL home page