(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE312

PENCW_10.PE312       Location/Qualifiers
FT   CDS_pept        join(complement(712696..713956),complement(711621..712642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978074"
FT                   /orf_name="Pc13g03120"
FT                   /product="Pc13g03120 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91381.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001830F79"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U9"
FT                   /transl_table=1
FT                   /translation="MASHDQNQGTAYCPGDMKHRSVSPSPHGQQYHDPNSGGLGVDPSM
FT                   ASYSTNPSFQNPDSSIGGAEAYAYPSYLAGAPSTQTLSPPADHSYAPTINTNNLPISQS
FT                   FETSLVNQLEHSSTGLRPMQGDENFSNMLNSNHPELDFSLYQNHSPNSASTPEYDSSLL
FT                   LDPQMHQRQSINQAINPADLVSPISNPSVSSHPSSRDQQNSSPGPMSPPGSTPGAYYTP
FT                   RHSRHTSLDPATAAYLTAQPGPDWQSVMNNVSFQGHRRAPSEVSEVSSANHSPYLSQHE
FT                   FDGIENNASPSLVPQSDPSLYDNGLGMESFTLSEQHQQGISPLHSPYISPRLMPQQGGE
FT                   MVPNNSYLTQFPSAPTDMYGMPQEDMMNMNQLNNPPGDIGQASQMAPPSINVEFAPPLR
FT                   NPTVDTSKSTADFDSLSPPAMRSRVRSKSDPYHPASRSRSPATSSTSLEPRAPASPRSL
FT                   SPVGSVGSHSRSSPSSRDPSPSRSNRRLSTSSIENRNYILDLADPQRPGAAPGEPKRIQ
FT                   KHPATFQCTLCPKRFTRAYNLRSHLRTHTDERPFVCTVCGKAFARQHDRKRHEGLHSGE
FT                   KKFVCRGELSRSGQWGCGRRFARADALGRHFRSEAGRVCIKPLLDEESQERDRVLLERQ
FT                   QQQQQSPSGHLQPIPQPLVMPNMPGMDGQSTGNFVLPAALLAQYPALQTLQWDQISAVG
FT                   DDPGDIGGRSSFDASSGGEFGFDEDDSGMGGGYGNNQGGMYGVDNSGQMLGVNPGDPGY
FT                   SDQKWTG"
     atggcctcgc atgaccagaa ccaaggcacg gcctattgcc ccggggatat gaagcatcgg        60
     agcgtgagcc cttcgccgca cggccaacaa tatcacgacc ccaactccgg tggattagga       120
     gttgacccct ccatggcctc ttattcgaca aacccctcct tccagaaccc tgacagcagc       180
     attggtggtg ccgaagcata tgcataccca agctaccttg ctggggcacc ctcgacacag       240
     acattatcac cgccggcgga ccatagctat gctccaacca tcaatacaaa taatcttccg       300
     atatcgcagt cgttcgagac aagcctggtc aatcagctcg agcactcttc gacaggcctc       360
     aggccgatgc agggcgacga aaacttctcc aatatgctca actcgaatca cccagaattg       420
     gacttttctc tttaccaaaa tcacagcccc aacagcgctt ccacccccga gtacgattct       480
     tcgttgttgc tagacccgca aatgcaccag cgccagtcaa tcaaccaagc gataaacccc       540
     gctgatctcg tcagccccat ctcgaatcct tcggtatctt cgcacccatc atcgcgagat       600
     cagcagaatt cctcacctgg ccccatgtct cctccaggat ccacaccagg tgcatactac       660
     acccctcggc attcacggca cacttccctt gacccagcta ctgcggcata tttgaccgcc       720
     cagccaggtc cagactggca gtcggttatg aataatgttt ccttccaggg ccatcgacgt       780
     gcgccatctg aggtgtccga ggtctcgtcg gccaaccact ccccctacct gtctcagcac       840
     gagttcgatg gcattgagaa caatgcgtcg ccttctttgg tcccccaaag tgatccgagt       900
     ctatacgaca atggcctagg catggaatca ttcacgttgt cagagcagca tcagcagggg       960
     atcagtcccc tccacagccc gtatatctct ccgcggttga tgccacagca ggggggcgag      1020
     atggtgccga ataattccta tctcactcag ttcccgtcgg cgccgacaga tatgtacgga      1080
     atgccccaag aggacatgat gaacatgaac caattgaaca atcccccggg cgacattggt      1140
     caagcttcac agatggcccc tccatcgatc aatgttgaat ttgccccgcc attgcggaat      1200
     ccaaccgtcg atacatctaa atccaccgca gactttgact cattgagccc tcccgctatg      1260
     cgatcccgtg ttcgtagcaa atccgatcct tatcaccctg cttcccgctc acgctctcct      1320
     gcaacttcct cgacgtctct ggagccccgc gctccggcca gcccacggtc tttgtccccc      1380
     gttggatcgg ttggctctca ctcgcgcagt agccccagtt cgcgggaccc ctcgccctca      1440
     cgatcaaacc gacgcctctc tacctcatca atcgagaacc ggaactacat cttagatctc      1500
     gccgatccac aaagacccgg agcagcaccg ggtgagccaa aacgaatcca gaaacacccg      1560
     gctaccttcc agtgcaccct atgtccgaaa cgcttcaccc gcgcatacaa tctgcgatcc      1620
     cacctccgca cccacactga cgaacgacca ttcgtatgca cagtgtgcgg taaagcattt      1680
     gcacgacagc acgaccgcaa acgccacgaa ggcctccatt ccggcgaaaa gaaattcgtc      1740
     tgccgcggcg agctctcgcg aagcggacaa tggggttgtg gccgccgatt cgcccgtgca      1800
     gatgctctgg gccgccattt ccgctccgag gcgggccggg tatgcatcaa gcctctcctc      1860
     gacgaggagt cgcaagagcg cgaccgtgtc ttgctagagc gccagcagca gcaacaacaa      1920
     tcgccatccg gccatctcca gcctatcccc cagccgctcg ttatgcccaa catgcccggc      1980
     atggatgggc aatcgacggg caacttcgtc cttcctgcgg ctcttctggc gcaatacccg      2040
     gctctgcaga cgttgcagtg ggaccagatc tcggctgtgg gtgatgatcc gggtgatatt      2100
     ggtgggcgga gtagctttga tgctagctct ggtggggagt ttggttttga cgaggatgat      2160
     tcggggatgg gtggtggtta cggtaataac caggggggta tgtacggtgt cgataactct      2220
     ggtcagatgt tgggggttaa tcctggggac cctgggtatt ctgatcagaa gtggactgga      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page