(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE315

PENCW_10.PE315       Location/Qualifiers
FT   CDS_pept        join(723538..723702,723843..724124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824881"
FT                   /orf_name="Pc13g03150"
FT                   /product="Putative uncharacterized protein Pc13g03150 "
FT                   /protein_id="CAP91384.1"
FT                   /db_xref="UniParc:UPI0001830F7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V2"
FT                   /transl_table=1
FT                   /translation="MPKAATLKTTPLMQKSPLKLKPPVGNLEMITQPLEPSKVPRKKEH
FT                   PGQQRDFKNTRCKLRRWPRESPEERGFAWLSHLVSGYGQGTVSAKKGLARLGSPSWVPT
FT                   GGYLSALELFWGWREIPPRFSVHQSGGCIIESGYCGVDGIWRTE"
     atgcccaaag cagcaaccct caaaacaact ccacttatgc agaaaagccc attgaaactc        60
     aaacccccgg ttggaaactt ggaaatgatc acgcaaccct tagaaccttc caaggttcca       120
     agaaagaaag agcatcccgg acaacaaaga gacttcaaaa acactcgctg caaattgagg       180
     cgttggcctc gggaaagtcc cgaagaacgg ggatttgcat ggctctcgca ccttgtctcc       240
     ggttatggtc aggggacggt aagcgcaaaa aaagggctcg cgcggctggg tagcccatcg       300
     tgggtaccga caggcgggta cctttctgcg ctagagctgt tctggggttg gcgtgagatt       360
     ccaccgagat tctccgtgca ccaatcaggg ggctgtatta tagagagcgg ttactgcggt       420
     gttgacggga tttggcgtac ggagtag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page