(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE316

PENCW_10.PE316       Location/Qualifiers
FT   CDS_pept        join(724299..724417,724513..724797,724894..724972,
FT                   725206..725272,725781..725894,725993..726087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949875"
FT                   /orf_name="Pc13g03160"
FT                   /product="Putative uncharacterized protein Pc13g03160 "
FT                   /protein_id="CAP91385.1"
FT                   /db_xref="UniParc:UPI0001830F7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V3"
FT                   /transl_table=1
FT                   /translation="MGPKIEPGKTAIYGDVAVDHRIREIGTQRQKNESMDRASMYVLRT
FT                   DPLILSFLSHGRVTFNIHTSGATPQRLVSVIKPIDLTLAPFSVFVIVRRCRVVVRAMLA
FT                   AVIELSLPYALELGIRVSWGAFFGDSGFDSGTRHVIKVFSRVSFHGPHPGWVHNKRQTL
FT                   VGEWDTISDHFDSLELNRADGDQSVLMHQDHSPDWLRTHPNAHPVLSDPSEITQPALAG
FT                   KCGVNDPSTCLLPDMVVTPARRLSHSLSAV"
     atgggtccca aaattgagcc cggcaaaact gctatatacg gcgatgtggc tgtcgatcac        60
     aggatccggg agattggaac gcaacggcag aagaatgaat ccatggatcg agcttcgatg       120
     tatgtactcc gtacagatcc cctgatcctt tccttcctct cccatggtag agttacgttt       180
     aatatccaca ccagcggagc gacacctcaa cggctcgttt cagttataaa accgatcgat       240
     ctgaccttgg caccgttttc cgttttcgtc attgtgcgca ggtgccgggt ggtggtcagg       300
     gcaatgttag cggcagtcat tgaactttct ttgccctatg ccttggaact aggaattaga       360
     gtttcttggg gtgctttttt cggggactcg ggtttcgact cgggtacacg ccatgtcatc       420
     aaagttttct cccgtgtgag tttccacggt ccgcatcccg gttgggtcca caacaaaagg       480
     cagaccttag ttggcgaatg ggacacaata tccgatcact tcgatagtct cgagctgaac       540
     agagcggatg gtgaccaatc cgtccttatg catcaagacc actcccctga ttggctacga       600
     actcatccca acgctcatcc cgtcctaagc gatccgagcg aaatcacaca acccgcatta       660
     gcaggtaagt gtggcgttaa tgatcccagc acctgtctac taccggatat ggttgttacc       720
     cccgctcgtc gtctctccca ctctctttcc gctgtttag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page