(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE317

PENCW_10.PE317       Location/Qualifiers
FT   CDS_pept        complement(727497..728456)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949876"
FT                   /orf_name="Pc13g03170"
FT                   /product="Pc13g03170 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91386.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0001831045"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V4"
FT                   /transl_table=1
FT                   /translation="MPASHRRGPWVPEEDQLLTQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKKRGLSTPTTSRTYSGRIEAPYTRASAMSPSRSRFSSSSASSSRPSWTESIESAISE
FT                   QYSHSRRESLASSARQLSPIYTLPSINRPIETPLTSPAFSEASHATSCEPPSMVSDHNS
FT                   VCSSSPRTFPSPQLLPLPVDLRSQYEIRRPSVHVVEDSPSYPARSLESLSDMASAQRWM
FT                   GHQPTLASWHQPTDLPKSYIPKPEPVRDTRMGVNNLLN"
     atgcctgctt cacaccgtcg tggtccttgg gtcccagagg aagaccaact cctcacccaa        60
     ctggtccgcg aacaaggccc aaacaactgg gttcgcatct ctcaacacat gcactaccgc       120
     tcgcccaagc aatgtcgcga gcgttttcac caaaatctca agccctcgct aaacagagag       180
     cccatctccg ccgaagaggg tctgatgatc gagcgcatgg tcaacgaaat gggaaagcgc       240
     tgggccgaga tcgcccgccg cctcggcaac cgcagcgaca acgcagtcaa gaactggtgg       300
     aatggtagca tgaaccgcaa gaagcgcggc ctgtccaccc ccaccacctc ccgcacttat       360
     tcaggccgta tcgaggcacc ctacacccgc gcctcagcga tgagcccatc ccgctctcgc       420
     ttctccagct cttctgcttc ttcttctcgc ccctcatgga cagagtctat cgagtccgcc       480
     atctctgaac aatactccca ctcccgcaga gaatccctgg cttcttccgc ccgccagctc       540
     tctcccatct atacccttcc ttccatcaac cgaccaatcg aaactcccct cacctcacct       600
     gctttctccg aggcttcaca cgctacctcc tgcgagccgc cttctatggt ctcagaccac       660
     aattccgtct gctcttcttc accccgcaca ttcccctctc cgcaactcct gcctttgcct       720
     gtcgacctgc gttcgcagta cgagatccgg aggcccagcg tccatgtcgt cgaggactcg       780
     ccaagttacc cggctcgctc tctagagtca ctgtcagata tggcctccgc acagcgctgg       840
     atgggtcacc agcccaccct ggcctcatgg caccagccta cagacttgcc caagtcttat       900
     atccccaagc ctgagcctgt tcgtgacact cgtatggggg tgaacaacct gctcaattga       960
//

If you have problems or comments...

PBIL Back to PBIL home page