(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE318

PENCW_10.PE318       Location/Qualifiers
FT   CDS_pept        join(complement(738857..740544),complement(737464..738806),
FT                   complement(736196..737085),complement(735512..736138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949877"
FT                   /orf_name="Pc13g03180"
FT                   /product="Pc13g03180 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91387.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831046"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V5"
FT                   /transl_table=1
FT                   /translation="MYPTVAPFPSVQPHQRIHYNTDTLNQQMYDANDQLPVHNDPSKPP
FT                   FNTIPRSRIPLPHPVQRLDPRDGSGYSSSTNMAEHTLRRKTPNGTLAAGYDGTLGDTVQ
FT                   PPAPKHILVSPMESGQFIPPQQGMQSENWQPMDQSATKQMNFPPVFKNDPAGNTIQGEV
FT                   VQDVNGTSWVRPVNYPPGVDSMLNQTLPLQPSQRYLLQNGQYVPTVLPATLQSCLGPTA
FT                   SAGTGPFGPYWPDGVYIPYRPAAFRDARFESPSPFTKQMSQPFYDLNQPTFNQAQVPLG
FT                   SHTDSGVAWGQSMPGLPTQDSLMKPLFPPRHSDQLPFHTRANRPLSGHPPPQSLNNEPT
FT                   NWSSRPLHGFQTPGPAVVVNADFKEKVLSEAHGVYVDLLATIHQARRNSVSNAAVDGYP
FT                   RFLKPSIYPKPPRQPGLDFSQAPPPDLTRHNSYPASQYDLQRQKFNAGSLRSNDPTSIP
FT                   RVQTRRPSLNQFAHSRGSDTHMLGLRDTGCPSGVSPFTRARGSLFNEGSPMSNAASALS
FT                   MLSDLCAESRWEWIDGMLLGGCLAYGLGDYHKAVRWYSRIITRDSTHVEAISNLAATML
FT                   ALDRREEASQHWLRAVQLRPSFFEAVEHLIGLLCNSHRGREAVNIIDFVQTSLRHPKDG
FT                   DCFKTDEHASEPESDAESNVSDACMYDKASFEYEDDMGQTQGIEPSSPDAKPLGFASSG
FT                   YAISGAENGRMLALVHAKGNMLYALGDNAGAAAAFEDAVLIAAGRRRHGIQSIIKQIFA
FT                   AFSSGPSNGYPQPEHDSKESILLYPDAALKTAKLVFPASGMPPGLQYVAEGISRNAATS
FT                   TTSNSLLSLAKIYQDGMSSVGSSGATRSSPGVRDILALYYLSLSLQPSPSTANNVGILL
FT                   AGIQNNPPARGSVRSNGETQHHLEIPGVVPGSGISLALAYYNYGLHLDSRHAHLYTNLG
FT                   SLLKDIGQLHAAIKMYEQAVQCDGNFDIALANLANAVKDSGKVNDAIVYYKRAVKVNPE
FT                   FAEAVCGLANALNSVCNWVGRDYPLSKYRRPQLPGALSAPNAPTVLPFHTFTCPLTAKQ
FT                   IRQISQRNGLRISTSTLRLPWLPATVFPPPSPPSPYLRVGYVSSDFNNHPLAHLMQSVF
FT                   GLHDPSRVKSYCYATTPSDKSVHRQQIEKEAPVFYDASGWSVDRLVQQIVGDGIHILVN
FT                   LNGYTRGARNEVFAARPAPIHMSFMGFAGTLGAEWCDYILADELSIPPETLSPGRRKTR
FT                   IGDRLLEEDNGEEVEDWVYGEKIVFTRDTFFCCDHRQSAPDASEKHVSWEEEQARRWRM
FT                   RKELFPKLSDDTIILGNFNQLYKVEPTTFRTWLRILARIPNAVLWLLRFPDTGEQNLRD
FT                   IAKAWAGEETASRIIFTDVAPKNTHIARAKILDLFLDTPECNAHTTATDVLWSGTPLLT
FT                   LPRYKYKMCSRMASSILSSALPSSEAGQRAREELIASSDEDYENKAIRLCLDLQYSGHE
FT                   GYARGRLTDIRQMLFRDRYKNKLFDTARWVRDLETAYEAVWAQWVNGEEGDIWL"
     atgtatccga ccgtcgcacc gttcccctcg gtccaaccgc accaacgcat ccactataat        60
     accgacaccc tcaatcagca aatgtacgat gcgaacgacc aactccccgt ccataatgac       120
     ccctccaaac ctcccttcaa tacaatacca cgatcgcgca tcccactacc tcaccccgtt       180
     caacgtctcg atcctcgcga tggctccggc tatagttcca gcactaatat ggctgaacac       240
     accctgagga ggaaaacacc caacggaact ctggctgcgg ggtatgacgg gactcttggc       300
     gataccgttc agccaccagc gcccaagcat atcttggttt cgccgatgga atcgggccag       360
     ttcattcccc ctcaacaagg gatgcagtct gaaaattggc agcccatgga ccagtcagca       420
     accaaacaaa tgaatttccc acccgtcttc aaaaatgacc ccgcaggcaa tacaatccaa       480
     ggagaagtcg tgcaagacgt gaatgggacg agctgggttc gtccggtcaa ttatcctccg       540
     ggcgttgact ccatgttgaa ccaaaccttg cccctccagc catcccaacg atatctctta       600
     cagaacgggc agtatgtgcc cacggtccta ccggcaaccc tgcagtcgtg tctcggacca       660
     actgcttccg cgggtactgg gccgttcggt ccatattggc cggatggagt atacattcca       720
     tatcgtcccg cggcatttcg tgatgcgcgt tttgaatccc cgtcgccctt tacaaagcag       780
     atgagccagc cattttacga cctcaaccag ccgactttta atcaagctca ggttccgcta       840
     ggcagccaca cagattcggg ggtcgcatgg gggcagtcca tgcctggttt gcctacccag       900
     gactctttga tgaagcctct tttcccacca cgtcactcgg accaactgcc ttttcacacc       960
     cgagccaacc gtcctctatc aggccatcca ccgccgcagt cactgaataa cgagcccacg      1020
     aattggtcga gtcgcccatt acatggattc cagaccccag gccctgcagt agtagtcaac      1080
     gcggatttca aggagaaggt cttatccgag gctcatggtg tctatgttga cctcctcgca      1140
     accatccacc aggcccgccg caacagcgtt agtaacgctg ccgttgacgg ttacccccga      1200
     ttcttaaagc caagtatcta ccctaaaccc ccacggcaac cgggtctcga cttttcacaa      1260
     gcccctccac ccgacctcac acgccataac agttacccgg ctagtcaata tgacttgcaa      1320
     cggcagaaat ttaatgcggg cagccttagg tcgaatgatc ctacgtctat tcctcgtgtc      1380
     caaactcgcc gcccatcctt aaaccaattc gcgcatagca gagggtcaga tacccatatg      1440
     cttggattgc gagacacggg ttgtccttcg ggggtgtcgc ctttcaccag ggctcgtggc      1500
     tctcttttca acgagggctc gcctatgtct aatgctgcgt ctgctttgtc aatgctctct      1560
     gacttgtgtg cggagagccg ttgggaatgg atcgacggaa tgcttctcgg gggttgtttg      1620
     gcctatggct tgggtgatta tcataaagct gtgcgatggt actccaggat catcactcgt      1680
     gactcgacgc atgtggaagc tatctccaac cttgctgcca ccatgttggc actcgatcgc      1740
     cgagaggagg cttcgcaaca ctggttgcgc gccgtgcaac tacggccgag cttctttgaa      1800
     gccgtggaac atctaattgg attactatgc aatagccaca gaggcaggga agccgtcaac      1860
     atcattgatt ttgtccagac ttcccttcgt catcccaaag acggcgattg cttcaagaca      1920
     gatgaacacg ctagcgaacc cgagagtgat gccgagagca acgtgtccga cgcctgcatg      1980
     tacgacaaag cgtctttcga gtacgaagac gacatgggac aaacgcaagg aatagaacct      2040
     agctcaccgg atgccaaacc ccttggtttt gcgagcagcg gatatgcaat ttcaggtgcg      2100
     gagaacggga gaatgctagc tttggttcac gccaaaggta atatgcttta tgctcttggt      2160
     gataatgcgg gtgctgcagc tgcgtttgag gatgccgttc tcatcgctgc tggccgaagg      2220
     cgacatggca tccaaagcat tatcaagcag atttttgctg ctttttctag cggtcctagc      2280
     aatgggtacc ctcaacccga gcatgattcc aaggagagca tcctgctcta tccagatgca      2340
     gcattgaaaa ccgccaaact tgttttccca gcaagcggca tgccgccggg gctccaatat      2400
     gttgctgaag gcatttctcg caatgcagcc acttccacca ccagcaactc tctcctttca      2460
     ttggcgaaga tttaccagga tggcatgtcc agcgtgggtt cctcaggagc aaccaggtct      2520
     tcccccggtg tccgggatat tttggctctc tattatcttt ccctctctct gcagcctagc      2580
     ccatccactg caaacaatgt tggaattttg ctggccggaa ttcagaacaa tccaccagcg      2640
     agaggttcag tgcgttcaaa tggtgagacc cagcaccacc tcgagatccc tggcgttgtc      2700
     cctgggagtg gaatatccct agccttggca tattacaact atggcttgca tctcgactcg      2760
     cgacatgccc atctctatac caaccttggc agcctactta aggacatcgg gcagcttcac      2820
     gccgccatca agatgtacga gcaggcagtt cagtgcgatg gcaacttcga tatcgccttg      2880
     gcaaacctgg ccaatgctgt caaggatagt ggtaaggtca acgatgccat tgtatactat      2940
     aagcgcgctg tcaaggtaaa ccccgagttt gccgaggcgg tttgcggatt agcgaatgcc      3000
     ttgaattctg tctgcaactg ggtaggtcgt gattatcctc tctctaagta tcgtcgacct      3060
     caactccctg gagctctttc tgccccgaat gcacctaccg ttctgccgtt ccataccttc      3120
     acttgtcccc tgacggcgaa gcaaatccgt cagatctccc agcgtaatgg actgcggatc      3180
     tcaacctcaa ctctcagact tccgtggttg ccagctactg tcttccctcc tccgtctccg      3240
     cctagtccgt accttcgagt tggttacgtg tcatcggact tcaacaatca ccctctcgca      3300
     catctgatgc aatctgtgtt tggactgcat gatccttccc gcgtcaagtc atactgttac      3360
     gctacaaccc ccagtgacaa atcggtgcat cggcagcaga ttgagaaaga ggctcccgtc      3420
     ttctatgatg cgagtggatg gtcggtcgat cgactagtcc agcagattgt tggggatggg      3480
     attcacattc tggttaactt gaacggttac acgcggggag ctcgcaatga ggtctttgct      3540
     gcacgcccag cgcctattca catgtcattc atgggttttg caggcaccct cggtgccgag      3600
     tggtgtgatt acatcctcgc tgatgagctt tctattccac cggagacatt gagccccggg      3660
     cggcgtaaaa cacggatcgg ggatcgtctc ctggaagaag acaatggcga ggaagtcgag      3720
     gactgggttt acggagaaaa gattgttttt acgcgcgata cctttttctg ctgtgatcac      3780
     cgacagagtg ccccagatgc tagtgaaaag cacgtatcat gggaagaaga acaagcccgg      3840
     cgctggagaa tgcgcaaaga attattcccc aagttgagtg acgatactat catcttgggt      3900
     aatttcaacc agttgtacaa ggttgaaccc acgacgttcc gaacatggct gcgcatactc      3960
     gcgcgaatcc ccaacgctgt tctctggctc ctccgcttcc cagacactgg cgaacaaaac      4020
     ctacgagaca ttgctaaagc ctgggccggc gaagagacgg cttcgcggat catcttcacg      4080
     gacgtggctc caaagaacac acacatcgcg cgagcgaaaa tcttagactt gtttctcgac      4140
     acgccagaat gcaacgccca caccacagca acagatgtcc tctggagcgg caccccgcta      4200
     cttactctcc cacgctataa gtacaaaatg tgctcccgca tggcgagcag tattctcagt      4260
     agcgcgctcc ccagctctga ggctggccag cgcgcccgtg aagaactcat cgcgtcgtcg      4320
     gacgaagact acgagaataa ggctatccgt ctatgtctgg atctgcagta ctctggtcac      4380
     gagggctacg cccgcggccg gctgacggat atacggcaga tgctgttccg ggaccgttac      4440
     aagaataagc tcttcgatac ggcgcgctgg gtgcgcgatc tggagactgc ttatgaggcc      4500
     gtctgggcgc agtgggttaa cggcgaagaa ggcgatatct ggttatga                   4548
//

If you have problems or comments...

PBIL Back to PBIL home page