(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE319

PENCW_10.PE319       Location/Qualifiers
FT   CDS_pept        join(complement(744261..744264),complement(744169..744202),
FT                   complement(743642..744087),complement(743574..743587))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129247"
FT                   /orf_name="Pc13g03190"
FT                   /product="Pc13g03190 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91388.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniParc:UPI0001831047"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V6"
FT                   /transl_table=1
FT                   /translation="MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGED
FT                   IAKNTGDWKGLRVTVRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSI
FT                   PMDEIIEIARIMRTRSMAKELRGVVLEILGTAFSVGCQVDGRSPKDVSDDVKEGEIDIP
FT                   EE"
     atgcctccca agttcgatcc caatgaggtg aagatcatcc acctgcgtgt gactggtggt        60
     gaggtcggcg ctcagtccgc tctggccccc aagatcggtc ccctcggtct gtctcccaag       120
     aagattggtg aagatatcgc caagaacact ggcgactgga agggtctccg cgttaccgtc       180
     cgcctgacca tccagaaccg tcaggccgcc gtctccgttg ttccctccgc ttcttccctt       240
     gtcatcaagg ccctcaagga gcctccccgt gaccgcaaga aggagaagaa catcaagcac       300
     tccaagtcca tccccatgga tgagatcatc gagattgccc gcatcatgcg cacccgctcc       360
     atggccaagg agctccgcgg tgttgtcctc gagatcctcg gtactgcttt ctccgtcggc       420
     tgccaggtcg atggccgcag ccccaaggac gtctccgacg acgtcaagga gggcgagatt       480
     gacattcccg aggaataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page