(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE32

PENCW_10.PE32        Location/Qualifiers
FT   CDS_pept        73662..74771
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824589"
FT                   /orf_name="Pc13g00320"
FT                   /product="Putative uncharacterized protein Pc13g00320 "
FT                   /protein_id="CAP91101.1"
FT                   /db_xref="UniParc:UPI0001830DC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H178"
FT                   /transl_table=1
FT                   /translation="MVCLARFERAWLLRSLYSQSQRTLSNTVTTSDVKAPKATSFLQST
FT                   TLYPSSPTAQSWTSPLRSFPPETDIDTPTLTYPGTHTTTSEKENGIIEYLKVDDELGGS
FT                   GLIVEEQSSRTLLPFSLVEDEFAKAANGGARLSQYTVSSVDSDHDFTGSSEFVVYVPSD
FT                   QATLHQPAEVTSMKSSSSTGVFQSLSGQTSVGFSNRGTLPGTLGAVSRSKQKEIGSYVT
FT                   VNLEYSSHLFGNSRHHQPTQTTRNPPKFDDLDLSTLNPITKSQPMDSTKTVPATTTATK
FT                   NTVEQLGTDGSDASRVLSSHGVAVILGSISGASLLFAIIFYLHRFYFRRISTSSRGTGS
FT                   VTQPKADNPAATCPDMSEILEISRFSADS"
     atggtctgtt tggctagatt tgaaagagca tggttgctga gatctttgta tagccaatca        60
     cagcgaactt tgtctaatac tgtcacaacg tctgatgtta aggctccaaa agctacaagc       120
     tttctgcaat cgactacgct atacccttcg agcccaacag cccaaagttg gacctcgccg       180
     cttcgatcat ttccacctga gacagacata gacactccta ccctcacata tcctggcact       240
     cacaccacta ccagtgaaaa ggaaaacggg ataattgaat atctcaaggt tgacgatgag       300
     ctagggggca gcggactaat agttgaagag cagagctctc gcacgttact gcctttcagt       360
     ttagttgaag atgagttcgc gaaagcagcc aacggcggcg cgagattatc acaatataca       420
     gtgtcctcag ttgattccga ccatgatttt acaggaagct ctgaatttgt cgtttatgtt       480
     ccctcagacc aagccacttt gcaccagccg gctgaagtta cttcaatgaa gtcttcatct       540
     tcaacaggag tcttccaaag cctttctggc caaacttcag tgggtttctc caataggggt       600
     acacttccgg gaactttagg tgctgtgtct cggtcgaaac aaaaggaaat cggtagttat       660
     gtgaccgtga atctggaata ttcttcacat ttgtttggaa attctcgtca tcatcagcct       720
     acgcaaacaa cacgaaaccc ccccaaattc gacgacttag acttgagcac gctcaatccg       780
     atcaccaaaa gccagcccat ggattcaact aaaaccgtgc cggcgaccac gaccgccacg       840
     aaaaatacag tagaacaatt ggggacggac ggttctgacg catcccgggt tttgtcaagc       900
     catggtgtgg ctgtaatttt ggggagcatt tccggtgcta gtttgctatt tgcaatcatc       960
     ttttatttac accggtttta ctttcggcga attagtacgt ccagtagagg cacaggatca      1020
     gttacccaac cgaaagcaga caaccctgct gccacatgcc cagacatgtc ggaaattttg      1080
     gaaatatctc gattttctgc cgattcatga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page