(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE320

PENCW_10.PE320       Location/Qualifiers
FT   CDS_pept        join(complement(747241..747333),complement(747052..747182),
FT                   complement(746698..746992),complement(746171..746644),
FT                   complement(745023..746120),complement(744771..744964),
FT                   complement(744693..744717))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129248"
FT                   /orf_name="Pc13g03200"
FT                   /product="Pc13g03200 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAP91389.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0001831048"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V7"
FT                   /transl_table=1
FT                   /translation="MDYEALKDQWSDVEDRDGVRLSWNTFPSTRMEASRLVVPIAAVYT
FT                   PLKEKPDAPLLQYEPVTCKQPCRAVLNPYATVDVRARVWICPFCLSRNPLPPHYKDITE
FT                   NTIPPELHPQSTTIEYQLARPAPAPPIFVFVVDTCQEDDSLQAVKDSLIMSLSLLPPNA
FT                   LVGLITFGTMAQVHELGYTECAKSYVFRGNKEYTAKQVQEMLGLAGGMRPGAPQQQPAR
FT                   PPLGPAARFLMPVQQVEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLESSF
FT                   QNAGGRIMAFTSGAATEGPGHVVSPELKEPIRSHHDIDRDNIKYYKKAVKFYDALAKRA
FT                   ANNGHIVDIFAGCLDQVGLLEMKNLSNYTGGHMLLTDSFTSSQFKQSFVRVFDKDAADN
FT                   LLMGFNASLEVLTTKELKVTGLIGHAISLNKKSSSVGETECGIGNTCAWKMCGMDPSSS
FT                   YGIYFEIANQGGPAAVQPGPQRGVIQFLTYYQHSSGHYHLRVTTTARPLSGPAGDPTLA
FT                   QSFDQEAAAVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKN
FT                   FTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDTGDSLVMIQPTLDSYSLEQEG
FT                   AQPVLLDSASIQPAHILLLDTFFHILIFHGETIAEWRKAGYHEQEGYENLKMLLDQPKE
FT                   DARDLIADRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVSSQTIFTDDVSL
FT                   QTFMDHLMKLAVSGTS"
     atggattacg aagcgttgaa ggatcaatgg agcgatgtgg aagaccgcga tggcgtcaga        60
     ctcagttgga acactttccc gagcactcgc atggaagcgt cccgcttagt cgttcccatc       120
     gctgccgtct acaccccact gaaggaaaag cccgatgccc ctttgctaca atatgagccc       180
     gttacttgca agcagccctg ccgggctgtc ctcaacccat atgccactgt cgatgtccgc       240
     gcacgagtct ggatctgccc cttctgtctg tcacgcaacc ctctccctcc gcattacaag       300
     gatatcacgg agaacacgat acccccagag ctccaccccc agagcacgac gatcgagtac       360
     caattggcac gacccgcccc cgctcccccg atttttgtct ttgttgtcga tacctgccag       420
     gaggatgaca gtctgcaggc tgtgaaggac tccctcatca tgagcttgtc tcttctgccg       480
     cccaatgcgc tggttggtct gattaccttc ggtactatgg cccaagttca tgaactcggc       540
     tacaccgaat gcgcaaagtc atatgtgttc agaggcaaca aggaatacac cgccaagcag       600
     gttcaagaga tgctgggcct ggccggcggc atgcgccctg gtgctcccca gcaacagcct       660
     gcccgtcctc ctctcggccc ggctgcgcgc ttccttatgc ctgttcagca ggttgagttc       720
     cagatcacca atgtcctcga acaactccag cgcgatccct ggccagtggc caatgacaag       780
     cgtccccttc gctgcaccgg tgttgccctg agcgttgccg ttggtctact tgagagttcc       840
     ttccagaacg ctggaggtcg cattatggct ttcaccagtg gtgcagccac tgagggccct       900
     ggccacgttg tttcgcccga attgaaggag cctattcgtt cgcaccacga tatcgaccgg       960
     gacaacatca agtactacaa gaaagctgtc aagttctatg atgctctcgc taaacgcgct      1020
     gccaacaatg gccatattgt cgatattttc gccggctgtc ttgatcaagt gggtttgctg      1080
     gaaatgaaga acctctccaa ctacactggc ggtcacatgc ttctcacaga tagcttcaca      1140
     tcctcccagt tcaagcaatc gttcgtgcgt gtgttcgaca aggacgccgc cgacaacctc      1200
     ttgatgggct tcaatgcatc tctcgaggtg cttacaacta aggaacttaa ggtgactggt      1260
     ctaattggcc acgctatctc gctcaacaag aagtcaagct ccgttggcga gacagaatgc      1320
     ggtatcggta acacctgtgc atggaagatg tgcggaatgg acccatcctc cagctatggt      1380
     atctactttg agattgccaa ccaaggcggc ccagctgctg ttcagcctgg tcctcaacgg      1440
     ggtgtgatcc agtttttgac atactaccag cactcctctg ggcattacca cctgcgggta      1500
     accactactg cccggccctt gagcgggcct gcgggtgacc caaccctggc acagtccttc      1560
     gaccaagagg ctgccgctgt cctcatggcc cgtattgcag tattcaaggc ggaggttgat      1620
     gacggtccag acgtcctgcg ctgggttgat cgcatgctga tcagactctg ctcccgattc      1680
     gctgactacc ggaaggatga cccgacatca ttccgattgg aaaagaactt caccttgtac      1740
     cctcagttca tgttccatct ccgccgaagt cagttcctgc aagttttcaa caactcgccc      1800
     gacgagactg ctttctaccg ccatgtcttg aaccacgagg acaccggtga ctctctcgtc      1860
     atgatccagc ccactctcga ttcgtactct ctagagcaag aaggtgctca gccggtgctt      1920
     ttggactccg cttctatcca gcccgcccac attctcctcc ttgatacctt cttccacatc      1980
     ctcatcttcc atggtgagac tattgccgag tggaggaaag ccgggtacca tgaacaggaa      2040
     ggctacgaga acctcaagat gcttcttgac cagcctaagg aggatgctag ggatcttatt      2100
     gccgaccgtt tccctctgcc ccgcttcatc gtctgtgatg ccggtggttc ccaggcccgt      2160
     ttcttgctgt ccaagctgaa cccgtcgaca acccacacca cgggcggcta cggtggcggt      2220
     gtgtcatcgc agaccatctt cactgacgac gtgtcgctcc agacattcat ggaccacctg      2280
     atgaaacttg ctgtatctgg aaccagctag                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page