(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE321

PENCW_10.PE321       Location/Qualifiers
FT   CDS_pept        join(complement(749465..749654),complement(748862..749412),
FT                   complement(748034..748798))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949878"
FT                   /orf_name="Pc13g03210"
FT                   /product="Pc13g03210 protein"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAP91390.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI0001831049"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V8"
FT                   /transl_table=1
FT                   /translation="MIRQDAHRIDPKRRAVIDPKKRQFATPTYKQQDYAHRLNIYEIPP
FT                   TAEITLEQFEQWAIDRLKILAEIEACSYRNKSPAETESYITPLLQKFLPLSSNTSSPSG
FT                   AADPRLKNERQKDHYSHFILRLAFSATEDLRRRFARAETMLFKFRFQKDDTREKRAFID
FT                   SLNLDWEPVGDFEKTEIAKNLLSSTPGLRGLEDETWYKVDWEKVPELVERRSIFLKKGK
FT                   AYVPGREQLSMIVAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYS
FT                   EGEGYVDGSPITASSIDQLAQQHFPLCMKSLHVNLRKNNHLKHFGRLQYTLFLKGIGLS
FT                   LEECILFWRQSFKGKTDDEFNSQYKYNIRHAYGEVGGDVNRRGKGYTPYSCQKILGDSN
FT                   PGIGQTHGCPYRHYSVDNLVGFLQATGVSDKEVLRGVREDVGKMRYHIACNRVFEATHK
FT                   NEIKKVKEDGSWSQTDLDTIVHPNTYFKRSYLLKQMSKAPKDA"
     atgattcgac aagacgccca tcgtattgat cccaaacgac gggctgttat tgacccaaaa        60
     aagagacaat tcgctacccc aacatacaag cagcaggact atgcgcaccg cctgaacatt       120
     tatgaaatac ctcctacggc ggaaatcact ctcgagcaat tcgagcaatg ggccattgac       180
     agactgaaaa tcttggccga gatcgaagca tgctcttatc gaaacaagtc ccccgccgag       240
     acggagagct acattacacc tcttttgcag aaattcctcc ctctttcctc caatacctct       300
     tctccctcgg gcgccgcaga cccccgcttg aaaaatgagc gtcaaaaaga ccactactct       360
     catttcatcc tccggttggc cttctcggcc acagaggacc tccgtcgacg gttcgcccgc       420
     gccgaaacca tgctcttcaa attccgtttc cagaaggatg acacaaggga gaagcgcgca       480
     tttatcgata gtttgaatct cgattgggaa cctgtaggtg actttgagaa gacagagatt       540
     gcaaagaatc tcctcagctc cacgccaggg ctgcgtgggc tggaggatga gacctggtat       600
     aaagtcgact gggagaaggt tcccgagtta gttgaacgac gctcgatttt cctgaagaaa       660
     ggaaaggctt atgttcctgg tcgagagcag ctgagcatga tcgtggctga gtttaccgct       720
     cgcttggagc gcgcactcga gctcacaagt cgtgccctcc cacggctgga tgaggatgat       780
     cgtctaacac ccattctgaa tcatctttca aagaactttg gcagcgccga gtcggtatac       840
     tcggaaggcg aaggatatgt ggacggatct ccgatcacgg ccagctccat cgaccaactg       900
     gcccaacagc acttcccctt gtgcatgaag agcttgcacg tgaacttgcg caagaacaac       960
     catctgaagc acttcggtcg actacagtat acgctcttct tgaagggcat tggcttgtcc      1020
     ttggaggagt gtatcttgtt ctggcgtcag tctttcaagg gcaagaccga tgacgaattc      1080
     aactctcaat acaagtacaa tattcgtcat gcctatggcg aggtcggtgg agatgtgaac      1140
     cgccggggaa agggttacac tccctactcg tgccagaaga ttctcggcga ctcaaatcct      1200
     ggcattggtc agactcacgg ctgtccctat cgccattact ccgtggataa cttggtgggc      1260
     ttcctccagg ccactggcgt cagtgacaag gaggtcctgc ggggtgtacg tgaggacgtt      1320
     ggtaagatgc ggtatcatat tgcttgcaac agagtattcg aggcgacgca caagaacgag      1380
     atcaagaagg tcaaggagga tggatcgtgg agtcaaactg accttgacac gattgttcac      1440
     ccgaacactt acttcaagcg gagctacctg ttgaagcaga tgtctaaggc cccgaaggat      1500
     gcttag                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page