(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE322

PENCW_10.PE322       Location/Qualifiers
FT   CDS_pept        join(750313..750484,750554..751146)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950857"
FT                   /orf_name="Pc13g03220"
FT                   /product="Pc13g03220 protein"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91391.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI000183104A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V9"
FT                   /transl_table=1
FT                   /translation="MSHTTKQLRKAARIILIGAPGVGKGTQSERLLARFPQLVSISSGD
FT                   LLRENVRRRTPLGLEAEAAMQSGNLVPDSMILNLISDDMKSKGWLLPPRTSSVQPTASS
FT                   SSSSLADTSSSHSIDSSASFILDGFPRTATQAATLDSLVPVNFVVHLITPPSVILARIA
FT                   SRWVHEPSGRVYNTDFHPPKVPGKDDVTGEPLTQREDDSLETWKQRLRKFEETSKSLLE
FT                   HYDRQRCLFRAEGNSSDEISPKLFAEVERRFC"
     atgtcgcaca caacaaaaca gctccggaag gctgcgcgga tcatcttgat tggtgcaccg        60
     ggagtaggaa aaggaacaca gtccgagcga ctgctagccc gatttcccca gctggtttca       120
     atcagctcgg gtgatctgtt gagagagaat gtgcgccgac gcacacccct cggcctggaa       180
     gcagaggccg caatgcagtc cggcaatctt gttcccgact caatgattct gaacttgatc       240
     tccgatgata tgaaatccaa gggctggctc ctcccaccac gcacatcctc agtacaaccc       300
     acagcatcct cgtcatcttc ttctctagcc gatacttcct cctcccactc aatcgattcc       360
     tctgcctcct ttatcctcga cgggtttccc cgcaccgcaa ctcaggcagc aaccctggac       420
     agcctagtac ccgtcaactt tgtcgtgcac ctcatcactc caccatcagt gattcttgcc       480
     cgcatcgcat cgcgctgggt ccacgagccg tcagggcggg tgtataacac agacttccac       540
     ccaccaaagg tgccgggcaa agacgatgtt acgggcgagc cgctgacgca gcgagaggat       600
     gattctcttg agacatggaa gcagcgtcta cggaagttcg aggagacaag caaatccctt       660
     ctggagcact atgaccgtca acggtgtcta ttccgtgcgg agggtaacag ctccgacgaa       720
     atcagcccaa agctgtttgc cgaggtcgag cggcggttct gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page