(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE323

PENCW_10.PE323       Location/Qualifiers
FT   CDS_pept        join(complement(752077..752466),complement(751439..751927))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825153"
FT                   /orf_name="Pc13g03230"
FT                   /product="Pc13g03230 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91392.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI000183104B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W0"
FT                   /transl_table=1
FT                   /translation="MRWPPWSSESTNDEQKQTPSSWLSSAANKPSSILDWTAFTELRTI
FT                   IPTVVLTSGILIAVRFHRRYLRRIPDAPSISSSYLRRRSIFGQVTSVGDGDNFRIFHTP
FT                   GGRMAGWGWLPWKKVPTVKKDLKDKTIHIRLAGVDAPELAHFGRPEQPFARDAHTWLTS
FT                   YLSNRRVRALVHRQDQYSRVVASVFVRRAFDFPPFRRRDVSYEMLKRGLATVYEAKIGS
FT                   EFGGDKMEKKYRKAEWWAKKRARGLWKDYRRVGSGWESPREYKNRMGMGDPLPIEKGNG
FT                   KGNGKGKIGQK"
     atgcgatggc cgccatggag ctccgagtcg accaatgacg aacaaaaaca aacaccaagc        60
     tcctggctct cctccgcggc gaacaagccg agttccatcc tcgactggac ggcgttcaca       120
     gaactcagaa ccattatccc aactgttgtc ctaacaagcg gcattcttat cgcagtgcgc       180
     ttccaccgcc gttacctacg gcgcatcccc gacgcgccta gcatctcgtc ctcatatctt       240
     cgacggcgga gcatcttcgg ccaagtcacc agcgtcggcg atggagacaa tttcagaata       300
     ttccatacac cgggtggtcg catggccgga tggggctggc taccatggaa aaaggttcct       360
     accgtgaaga aggatctgaa ggataaaact atccacatcc gtctcgctgg cgtcgacgcc       420
     ccagaactcg cccacttcgg ccgccccgaa caacccttcg cgcgcgacgc acacacatgg       480
     ctaacatcat atctgtccaa ccgacgagtc cgtgccctcg ttcatcggca ggaccaatac       540
     tcgcgcgtgg tagcgagtgt cttcgtccgg cgcgcattcg acttcccgcc attccgtcgg       600
     cgggatgttt cttacgaaat gctgaagcgt ggcttagcga ctgtttatga agcgaagatt       660
     ggctcggaat ttggcggtga taagatggaa aagaaatacc gcaaggccga gtggtgggct       720
     aagaagcgag ccagggggct ttggaaggat tatcgtcgcg tcgggtctgg ttgggaaagt       780
     ccgagggagt acaagaatcg gatgggtatg ggagatcccc ttccgatcga gaaagggaac       840
     gggaaaggga atgggaaagg gaagattggg cagaaatag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page