(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE324

PENCW_10.PE324       Location/Qualifiers
FT   CDS_pept        752794..754293
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129519"
FT                   /orf_name="Pc13g03240"
FT                   /product="Pc13g03240 protein"
FT                   /protein_id="CAP91393.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000183104C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W1"
FT                   /transl_table=1
FT                   /translation="MTRPKESHGVAFLPRELFWMILGYLEPNELVRCRRVSRAWNEAFS
FT                   NPAVLLALLKKLFPWTDEVKSLGTETSVEEQDQGRRLFDQVASRYNYLARGKPRSIQKY
FT                   RLCDDFGSSGDREWYQVQPWESHASHMRRFVDRQFSEALWTFENGLLVYPSADHQCLVL
FT                   MDLETDRQFMVPFIIRGKVVRRVRLQKSLLVVEWAEPKAFHWLNDSDGVHRHFASSFDV
FT                   TRGENQGWSITPRNEWKIMFLGHPLSERDRFFSSHSNTHYVIYIWQPNRSLYTADEDAP
FT                   IESLFVWDISKVSSYRPSLDPTGRLRDDSPGDSPSIVARFGFRDLEFFDIRQRGCPSIQ
FT                   RLEITDDAQAVEITENVSIQPQDEPPEIFGLPEPITTSIPLVGNGPHWRRHFEGVLPPY
FT                   RGNCSMQAESMELNGCIMKDPWFGIISQVTVLEPNLGFCLHFDTWTWVQNQATYLSIQT
FT                   PRSTITCDNWDFVGRGKIAGSEKYLMGENCNRELVVYRFDR"
     atgactagac cgaaagagag ccatggtgtg gcattcctac ctcgcgaact cttttggatg        60
     attctaggtt atttagaacc aaacgagcta gtccgatgtc gccgtgtctc gcgtgcctgg       120
     aatgaagcct ttagcaaccc ggccgtccta ctcgcactcc tgaagaaact tttcccatgg       180
     acagacgaag tcaaaagcct gggcacggag acatcagttg aagaacaaga ccaaggtcgt       240
     cgtcttttcg accaggtcgc ttcacgatat aattacctag cacgaggcaa gccccgctct       300
     atccagaagt accgcctctg cgatgacttt ggtagcagtg gagaccgcga atggtaccag       360
     gtgcagccat gggagtcgca cgccagtcat atgaggcgct tcgttgaccg ccagttctct       420
     gaggctttat ggactttcga gaacggcctg ctggtctacc ccagcgcaga tcatcagtgt       480
     ctcgtgctca tggatttgga aacggaccgg cagttcatgg tgccctttat tattcgtggc       540
     aaggtcgttc gtcgagtacg gctgcagaag agcttgctcg tcgttgaatg ggctgaacca       600
     aaggccttcc actggctgaa tgatagcgat ggcgtgcatc gtcattttgc gtcctccttt       660
     gatgtgacaa ggggtgagaa tcagggatgg agtataaccc cgcgcaatga atggaagatt       720
     atgtttttgg gacatccgct gagcgagcga gatcggttct tctcctcgca tagtaacacc       780
     cattatgtga tttatatatg gcagccaaat cgcagcttgt acaccgccga cgaggatgcg       840
     cccattgagt ctttgtttgt ctgggacata tcgaaagtat catcataccg accttcattg       900
     gatcccacag ggcgactgag ggatgactca cctggtgact ctccatcaat cgtggcacga       960
     ttcggattcc gggatctgga gttcttcgac atccgacaac gaggctgtcc aagcattcaa      1020
     cgattggaga ttacggatga tgcccaggcg gtcgaaatta cagaaaatgt ttccatccag      1080
     ccgcaagacg aaccacccga aatatttggg ctgcccgagc ccattactac aagcatccct      1140
     ctagttggaa atgggcctca ttggcgccgg catttcgagg gagttttacc gccttaccgt      1200
     gggaactgca gcatgcaggc tgagagtatg gaacttaatg ggtgtatcat gaaggaccct      1260
     tggtttggca tcatttctca agtgactgtg ctcgagccga atcttggctt ttgtcttcac      1320
     tttgatactt ggacgtgggt acaaaatcag gctacctatt tgagtatcca aacacctcgc      1380
     tcgaccatta cttgtgacaa ttgggatttt gtcggtaggg ggaagatcgc tggtagtgag      1440
     aagtatctga tgggcgagaa ctgcaatcga gagcttgtgg tttaccggtt tgacagatga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page