(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE325

PENCW_10.PE325       Location/Qualifiers
FT   CDS_pept        join(complement(757275..757433),complement(756042..757206),
FT                   complement(755901..755934),complement(755599..755821),
FT                   complement(755386..755454))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978318"
FT                   /orf_name="Pc13g03250"
FT                   /product="Pc13g03250 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91394.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000183104D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W2"
FT                   /transl_table=1
FT                   /translation="MSTVTVATDAYAILGVERDAKLPDINIAYKRLALKLHPDKAGNSP
FT                   ATVERFRKIQDAVEVLRDEDRRRLLDEALKKKTKRHLDPEDDIPARVFKSNYNRSSKRE
FT                   HHTHDFKWSNPFAEPAWHHRQHTFSYYYSYGTSVHMDPESAESKAKRAQFEAENVQWEN
FT                   EWLGTDPEVQKARAELRKENMRARMKRDLADMAKGQDEDTKYADFDHVVEGVLDELNFG
FT                   HEDFVHVLPEENIKTCNPADTFDTFSYEYAKKSRSGADDPIHSDRASNPQSATGSDSSF
FT                   EFTTSSDSTSYTHSANGHSNFKSTVEDFESTTDNSESTTDDSNSDAEKLINSYMVGHDS
FT                   LLPVVSFLKQKLADPHGRYTLDDLGGELNGIMLEAYCGWLEEVRLSVPNASPVTVRNDP
FT                   KFCSHHGLWYKEFGRPVCNVCNLWMPTFILTCPGCGLNACVRYFPLVWISRCCRKKKKE
FT                   RGKAASITVDSAFAHSIDFNESRSRYHFVLMHRYSDLGLTSNSHRLLILSYVPSPLTGW
FT                   TPVFVLYLARIQDPDCHYDADVVELNPRKKYN"
     atgtcgaccg tcactgtggc caccgatgcc tacgccatcc ttggagttga gcgagatgcc        60
     aaactccctg acatcaacat tgcctacaag cgccttgcct tgaagctcca cccagacaag       120
     gctggaaatt cccctgcaac tgttgagcga ttcagaaaga ttcaagatgc tgttgaggtc       180
     ctccgtgacg aagaccgtcg gcgtttgctt gacgaggccc tgaaaaagaa gaccaagaga       240
     catctggatc ccgaggatga tataccggct cgggtcttca agagcaacta caatcgttca       300
     tcaaagcgag aacaccacac ccacgatttc aaatggtcga acccatttgc cgaaccagca       360
     tggcatcacc gccagcacac ctttagctac tactacagtt acggaacaag cgtgcacatg       420
     gacccggagt cggctgagtc caaggccaaa cgagcgcaat ttgaagcaga aaatgtccag       480
     tgggagaacg aatggcttgg tactgatcca gaagtgcaga aggcacgggc agagcttcgc       540
     aaagaaaaca tgcgggctcg gatgaagcgt gacctagcag atatggcgaa gggccaggat       600
     gaagacacca aatatgccga ttttgaccat gttgttgaag gagtcttgga cgaactcaac       660
     tttggccacg aagatttcgt gcatgtcctg cctgaagaga acatcaagac ctgcaaccct       720
     gctgacacat ttgacacatt ttcctatgaa tacgccaaaa agtcccgttc tggtgccgat       780
     gatccaattc actctgatcg cgcttcgaat cctcagtctg ctactggcag cgattcatcc       840
     tttgagttca caacaagtag cgactccacc agctacaccc attcagccaa cgggcactcg       900
     aatttcaagt caaccgttga agactttgaa tctactactg ataactccga atccaccact       960
     gacgactcca actctgacgc tgagaaactg atcaactcct acatggtcgg ccacgattcg      1020
     ttgctccctg tagtctcatt cctcaagcaa aagctcgccg atccccatgg acgctacact      1080
     cttgatgatc tcggcggtga acttaatggt atcatgctgg aggcctattg cggctggttg      1140
     gaagaggttc gtctttcggt cccaaatgcc tcgcctgtta cagttcggaa tgaccccaag      1200
     ttttgctccc accatggtct atggtacaag gagttcggtc gtcccgtgtg caatgtttgc      1260
     aacttgtgga tgccaacatt catccttacc tgtcctggtt gcggtctgaa cgcctgtgtc      1320
     agatattttc ctttggtctg gatttcgcgc tgttgtcgga aaaagaaaaa ggaaagagga      1380
     aaggctgcca gtatcacggt ggattcggcg ttcgctcatt ctatcgattt taatgaatct      1440
     cggtcaagat accacttcgt tctcatgcac agatatagtg acctcgggct cacctcgaac      1500
     tcacatcggc ttctaattct atcctacgtg ccctctcctc ttacaggatg gactcctgtc      1560
     tttgtgctct atttggccag gatccaagac cccgattgtc actacgatgc cgatgtggtc      1620
     gagctcaatc ctcgtaagaa gtacaattga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page