(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE327

PENCW_10.PE327       Location/Qualifiers
FT   CDS_pept        join(760100..760154,760379..760605,760692..762176,
FT                   762227..762469,762535..762984,763040..763174)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978319"
FT                   /orf_name="Pc13g03270"
FT                   /product="Pc13g03270 protein"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAP91396.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="UniParc:UPI000183104F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W4"
FT                   /transl_table=1
FT                   /translation="MSSSEDDAPLMRANGRVKVSPKSPEVVKMADSSPATNGHVDPGIS
FT                   IRFGPVEDKDVKMEDGEDALGAGKRKSRTSVGEKKSYAEAESSEEDEPLSKRRRTSVKH
FT                   EDPETDDDVPLARNGRKLPKPAETSIGDESDSDVPIERKLAVQKKKIEQTAEAKPSRKP
FT                   AAPKKEAKPAAAKKQTNGVKKEPAASKAAPKKGKAKVKEESQDAEEKDEEEEEEYRWWE
FT                   DQSKGDGTIKWTTLEHNGVVFPPEYELLPQNVKMKYDGIPITLAPEAEEVASFFGTMLN
FT                   STHNVENPVFQKNFFSDFKDVIKKSGGAKDSKGNKVDIKEFAKCDFKPIFEFYDAQREE
FT                   KRHLPPAEKKAAKALKDEQEAPYQYCIWDGRKQKVGNFRVEPPSLFRGRGEHPKTGRVK
FT                   TRVQPEQITINIGKDAKVPPPPPGHKWKEVKHDQEGTWLAMWQENINGNYKYVMLAANS
FT                   DVKGQSDFKKFEKARELKKHIEKIRKDYQKNLKHDMMVERQKATAVYLIDQFALRAGNE
FT                   KGEDEAETVGCCSLKYENVTLKPPNTVVFDFLGKDSIRFYDEVQVDLQVFKNLKIFKKA
FT                   PKKNGDEIFDRLTTSALNKHLANYMPGLTAKVFRTYNASYTMGCVLNEMNASGGTIAEK
FT                   VKAYNDANRKVAILCNHKRTVTAGHANAMEKMGERIKGLRYQKWRLKQQMLDLDPTLKK
FT                   KKGAAFFEIDEDLDKEWIEEHQAFLIEEQRNKINKKFEKDNEKRVADGEKEMKVSELEE
FT                   RLQAVKELEKKFKKENKTGKVEAEARGATVEKLENSINKIDQRVETMSVQAQDKEDNKE
FT                   VALGTSKINYIDPRLTVVFSKKYDVPIEKFFSKALREKFEWAIKSVDEDWEF"
     atgagctcct cggaggacga tgcaccgctc atgcgcgcca atggacgtgt taaagtttcc        60
     ccaaagtccc ccgaggtcgt caaaatggca gactccagcc ctgccacaaa tggccatgtt       120
     gatcctggaa tttccatccg attcggtcct gtggaagaca aggatgtgaa gatggaagat       180
     ggagaagatg cgctgggtgc tggtaagcgc aagtctcgga ccagtgtggg cgaaaaaaag       240
     tcctacgcag aagcagaaag cagtgaagaa gatgagcctt tgagcaaacg ccgacgtaca       300
     tctgtgaagc atgaagaccc cgagaccgat gacgatgtcc ccttggcacg caacggacgc       360
     aaacttccca agcccgccga aacatccatc ggggatgagt ctgattccga cgtccccatt       420
     gaacggaagc ttgccgtgca aaagaagaaa attgaacaaa cagcggaggc taaaccttcg       480
     cgcaaacctg ctgcaccaaa gaaagaggct aagcctgcgg cggccaagaa acagacaaac       540
     ggcgtcaaga aagagcccgc cgccagcaaa gcggccccca agaagggcaa agcgaaggtg       600
     aaggaagaaa gccaggatgc cgaagaaaag gacgaagagg aggaggagga gtaccgctgg       660
     tgggaagacc aaagcaaggg cgatggaacc atcaagtgga caactctgga acacaatggt       720
     gtggtgttcc cccccgaata tgaactgctg cctcagaatg tcaagatgaa atatgacggt       780
     attccgatca ctcttgcacc tgaagccgaa gaggttgcta gcttcttcgg caccatgcta       840
     aactcaaccc acaacgtgga aaaccctgtg ttccagaaga acttcttcag cgacttcaaa       900
     gatgtcatca agaagagcgg cggagcgaag gattccaagg gcaacaaggt agacatcaag       960
     gagtttgcca aatgcgactt caagcctatc ttcgaattct acgatgccca gcgtgaggaa      1020
     aagagacatc tgccaccagc agagaagaag gctgctaagg ctttgaagga tgagcaagaa      1080
     gctccctacc agtactgtat ctgggatggt cgcaagcaga aggtgggcaa cttccgtgtg      1140
     gaaccgcctt ctctgttccg gggccgcggt gagcacccga agaccgggcg tgtcaagaca      1200
     cgtgtgcaac ctgagcaaat cactatcaat atcggcaaag acgcgaaggt cccaccgcca      1260
     cctcctgggc acaagtggaa ggaggtgaaa catgatcagg aaggcacctg gcttgccatg      1320
     tggcaggaaa atatcaatgg caactacaag tacgtcatgt tagctgccaa ttccgatgtc      1380
     aaggggcaaa gcgatttcaa gaaattcgag aaagcccgtg aactcaagaa gcacatcgag      1440
     aaaatccgta aggattatca gaagaacctc aaacatgata tgatggtgga acggcagaag      1500
     gccacggcag tctatcttat tgatcagttt gccctgcgtg ctggaaacga gaaaggtgaa      1560
     gacgaggccg aaaccgtcgg ttgctgttct ctgaagtatg agaatgttac actcaagcct      1620
     cccaacactg ttgtcttcga tttcttgggt aaggatagta ttcgtttcta cgatgaagtt      1680
     caggtcgatc tgcaggtttt caagaacctg aagatcttca aaaaggcacc caagaagaat      1740
     ggcgatgaaa ttttcgaccg ccttacgacg tctgccctca ataagcatct tgccaactac      1800
     atgccaggtc taaccgccaa ggttttccgt acgtacaatg cgtcttatac catgggttgt      1860
     gttctcaacg agatgaatgc ttctggcggt accatcgccg aaaaggtgaa agcatacaat      1920
     gatgccaacc gtaaggttgc cattttgtgt aaccacaagc gtactgtcac tgctggccat      1980
     gccaatgcaa tggaaaagat gggtgaacgg atcaagggcc ttcgatacca gaagtggcga      2040
     ctaaagcagc aaatgcttga cttggaccca actctgaaga agaagaaggg tgcggcgttc      2100
     ttcgaaatcg atgaggatct cgacaaagaa tggatcgaag aacaccaagc ctttttgatt      2160
     gaagagcaga gaaacaagat caacaagaag tttgagaagg acaacgaaaa gcgcgttgct      2220
     gatggcgaga aggaaatgaa ggtttccgag ctcgaggagc gcctacaggc tgtgaaggag      2280
     ttggagaaga agttcaagaa ggagaacaaa accggcaagg tcgaggccga ggctcgaggc      2340
     gcaacggtgg aaaagcttga gaattccatc aacaagatcg accagcgggt cgaaacaatg      2400
     tctgtccagg cccaggacaa ggaagacaac aaagaggttg ccctaggtac ctcgaagatt      2460
     aactacattg atcctcgcct cactgtcgtc ttcagcaaga aatatgacgt ccccatcgaa      2520
     aaattcttct ctaaggcgct ccgtgagaag ttcgaatggg ccatcaagtc tgttgatgag      2580
     gattgggaat tctaa                                                       2595
//

If you have problems or comments...

PBIL Back to PBIL home page