(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE328

PENCW_10.PE328       Location/Qualifiers
FT   CDS_pept        join(complement(765624..765669),complement(765405..765566),
FT                   complement(764418..765334))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978320"
FT                   /orf_name="Pc13g03280"
FT                   /product="Pc13g03280 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP91397.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831050"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W5"
FT                   /transl_table=1
FT                   /translation="MADAKKPAVLIVGGLGFIGRHLALYIHENNLASEVRLVDKVLPQL
FT                   AWLAPEFEEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGESRHSQPDDVYE
FT                   VRSYALSVALGKEIARRGIPAFIETSTAHVYKGGSTPRKETDKLAPWHKLAAWKLKAAE
FT                   ELLKVPNLQYCALRLPHVYGAYDPGYFATGICLSAVHVDLKQDLEFLHTKDLKINTLHV
FT                   KDAASALFEAAKWRAAKGFIDPKEGVVTFNVVDHNDTKQEHVANALTEVFGLKVSFIGS
FT                   LASQLAKLNLDDVLDDMNEVGLQTWAELVERANITRPGPISPFLERDIVRDQDMSIDGS
FT                   KFENETGWKPSYPNFGADSIREIVDSYKRMGWWP"
     atggctgacg ccaaaaaacc cgccgtcctg attgtcggtg gcctcggctt catcggtcga        60
     cacctcgcac tatacatcca cgagaacaac ctagcctcgg aagtccgttt ggtagacaaa       120
     gtcctgccac aattggcctg gttggcccca gaatttgaag aggcatgctc caaggacaag       180
     ttcgtccagg cagacgccag ccgtgaacaa catttcccgc gcatcttcga ccgagccaat       240
     ggcgaacaat tcgactatgt aatcaactgc ggcggcgaat cacgtcactc ccaaccagac       300
     gatgtctatg aagtgcgcag ctacgccctc tccgtcgcac tcggcaagga aattgcccga       360
     cgcggcatcc ccgcctttat cgaaacctcg accgcgcacg tctacaaggg cggctcaacg       420
     ccacgcaagg agaccgacaa gctcgccccg tggcacaagc tagccgcgtg gaagctcaag       480
     gctgcggagg aattgcttaa ggtcccaaac ctgcaatact gcgcgctacg cctaccccac       540
     gtctacggcg cctacgaccc gggctacttc gccacgggca tttgtctgtc cgccgtccac       600
     gtcgatctca agcaggactt ggaattcctg cacacaaagg acttgaaaat taacaccctg       660
     cacgtcaagg atgctgccag cgcgctgttc gaggctgcca agtggcgcgc cgcgaagggc       720
     tttatcgacc ccaaggaagg agttgtcacc ttcaatgttg tcgatcacaa cgatacgaaa       780
     caggaacatg tcgccaatgc cttgacagag gtgttcggtc tcaaggtctc gttcattggg       840
     tcgcttgctt cgcagctcgc caagctgaac ctcgacgatg tccttgatga tatgaatgag       900
     gtcggtctgc agacttgggc tgagctcgtc gagagagcca atatcacccg gcctggaccg       960
     atcagtccgt tcctggaacg tgacattgtc cgggaccagg atatgtccat tgacgggtcg      1020
     aagttcgaga atgagactgg ctggaagcca tcgtacccga actttggggc tgacagtatc      1080
     cgcgaaatcg tggacagtta caagcgcatg ggctggtggc catga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page