(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE329

PENCW_10.PE329       Location/Qualifiers
FT   CDS_pept        join(766436..766624,766744..766835,766931..767018,
FT                   767108..767185,767291..767461,767565..767630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950859"
FT                   /orf_name="Pc13g03290"
FT                   /product="Putative uncharacterized protein Pc13g03290 "
FT                   /protein_id="CAP91398.1"
FT                   /db_xref="UniParc:UPI0001831051"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W6"
FT                   /transl_table=1
FT                   /translation="MGYSEGSGCKDPRTGLQALHPIQKDGEGWDKGGALVGGPRAILRA
FT                   RHTIERRGNRQKTMSGLSSLVISGTFKSPYTDGYISSISSPGLYEPGGRMSGCGYSKAM
FT                   QPLSWSAIYQGCRHDQANFLQAGLYSPIFHFSLMGSGKVAVDGPWSHSSGGWLDWLNNE
FT                   QTIGTDTRGNIHWVTEGYLCKKNEKLAQRARVSASGGSGELRKSSTGLHPDPIRFPVYW
FT                   TIGDM"
     atgggatatt ctgagggttc aggttgtaaa gacccgagaa cgggccttca ggcacttcac        60
     ccaatccaga aggatggaga aggatgggac aagggcgggg cacttgttgg tggaccgagg       120
     gcgatcttgc gggcacggca cacaatcgaa cggcgaggaa accgtcagaa gacgatgagc       180
     ggcctttcat ccctggttat atcgggcact tttaagagtc cctatactga tgggtatata       240
     tcttctatat cttctcctgg tctgtacgag ccgggtggcc ggatgtctgg ctgcggctat       300
     tcaaaagcca tgcagcctct ttcatggtca gcgatttatc aaggttgccg tcatgaccag       360
     gccaacttcc ttcaagccgg actttactct cccatattcc acttttcact catgggctct       420
     ggaaaagtgg ccgttgatgg accatggtcg cacagctcag ggggctggct agactggctg       480
     aacaatgaac agacaatagg gacagacacg agagggaata tacactgggt cacggagggc       540
     tacctctgta aaaagaatga aaaattggcg caaagagcac gagtatcagc ttctgggggc       600
     agtggagaac tcaggaagag ctcaactgga ctgcatccag acccaatcag attccctgtt       660
     tactggacaa taggagacat gtaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page