(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE330

PENCW_10.PE330       Location/Qualifiers
FT   CDS_pept        join(complement(769716..769875),complement(769376..769661),
FT                   complement(768198..769323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825154"
FT                   /orf_name="Pc13g03300"
FT                   /product="Pc13g03300 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91399.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001830442"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W7"
FT                   /transl_table=1
FT                   /translation="MAIEDDEKNDQHGTDIASTVSADIVPIDMSEHGTMKRALKPRHSQ
FT                   MIALGGCVGTGLFVGTGATLALGGPAFLLTAFIVLIFLVYIIVTAIVEMVAYLPVGGAS
FT                   LSYYGTRYVSKSLGFAMGWLYVYSLGILVPYEITAGALVIDYWDSPVNVAVWITVFMVL
FT                   IVGLNLLPVEYYGESEFWFSTIKVFTIIGLLVLSIVLFWGGGPKQSGILGFHYWKDPGP
FT                   INTWLADGAGGRLVAFVRTLVLSAFPFTFSPELLIATSGEMQNPRKDLGKAANRFVIRL
FT                   IVFYLGTVLAIGVICPSNDEDLVSSGSNAKASAFVVGIKHAGIHGLGSVVNAAILTTAW
FT                   SAGNAYLYMSSRALYALAISGQAPKIFLRCTNRGVPYAAVLACSSFGVLAYLNCASSSS
FT                   TVFTWFVNITNTSAFISWVCCCIVYLRFRSAYNTQGKPELPYRSWTQPYGAWFALFFFL
FT                   LLTLINGFNVFFPGQLSASSFFTAYIGIPAFMVTYAGHKLLKGRSDPLWITSDEINIWD
FT                   GLENIH"
     atggcaatag aagacgatga gaagaatgat cagcatggaa ccgacattgc cagtactgtg        60
     agcgctgata tcgttcccat tgacatgtct gagcatggta caatgaagcg tgcgttgaag       120
     ccgcgccatt cacagatgat agccctcgga ggctgtgttg gaacgggcct tttcgttggc       180
     actggggcga cgttggcttt gggtggacca gccttcctgc tcactgcttt cattgttctg       240
     atctttttgg tttatatcat tgtgacggca attgtcgaga tggtagccta tcttccagtc       300
     ggtggtgctt cactgtcgta ctacggcact cggtacgtct ctaaaagtct gggctttgcg       360
     atgggatggc tctatgtcta ttctttgggc atcctggttc cgtacgaaat cacggcaggt       420
     gccttggtca tcgactactg ggatagcccg gtcaatgtag cagtctggat caccgtcttt       480
     atggtcctca tagtcggcct gaatttgcta cctgtggaat actacggcga gtcagagttc       540
     tggttttcga ccatcaaggt cttcacaatt attgggctgt tggtcctctc aattgtgctg       600
     ttctggggag gagggcctaa acagtccggc atcctgggct tccactactg gaaggacccc       660
     ggtcctataa acacttggct ggccgacgga gcaggtggca ggctcgtggc atttgttcgg       720
     acccttgtcc taagcgcgtt cccttttaca ttcagcccag agctacttat tgccacaagc       780
     ggagagatgc agaatcctcg aaaggacctc ggaaaagccg ccaaccgctt cgttattcgt       840
     ctaattgtgt tttaccttgg cacggtcctg gcaattggcg tcatttgtcc ttccaacgac       900
     gaagacctcg tcagcagtgg cagcaatgca aaggcctccg cttttgttgt tgggatcaag       960
     catgctggga tccacggcct gggaagtgtt gttaacgccg caatcctcac cactgcctgg      1020
     tccgctggca acgcatatct atatatgagc tcgcgagctc tttacgctct ggcaatttct      1080
     ggccaagcac ccaagatctt ccttcgctgt accaatagag gagtgcccta cgctgcagtt      1140
     ctagcatgca gctccttcgg tgttctggcc tacctcaact gcgctagcag cagctccacc      1200
     gtcttcacct ggttcgtcaa tatcaccaac acctctgctt ttatctcttg ggtgtgctgc      1260
     tgcatcgtgt acctacgctt ccgatcggcc tacaataccc agggcaaacc cgagcttccc      1320
     taccgcagct ggacccagcc atatggtgca tggtttgctt tattcttctt tcttcttcta      1380
     acacttataa atggctttaa tgtcttcttc ccgggacagc tttcggcatc gagctttttc      1440
     acggcttaca tcggcattcc tgcatttatg gtcacctacg ccggtcataa gctattgaag      1500
     gggcgatctg atccgttgtg gattacttct gatgagatta atatttggga tggcttggaa      1560
     aatatacatt ag                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page