(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE331

PENCW_10.PE331       Location/Qualifiers
FT   CDS_pept        770662..772047
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950860"
FT                   /orf_name="Pc13g03310"
FT                   /product="Pc13g03310 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="CAP91400.1"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI0001830443"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W8"
FT                   /transl_table=1
FT                   /translation="MAILKKPQPFKKALHFSEKEFEERQQRALKLMKQEGLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHKDGSKKLVTRMPDLRQALYTSVLTYNDIMIRSDDAD
FT                   SNPVSLVPLVLKEFGINSSSKRIGYEPNSATLTLEVGKLLEESVAGLCTLVNHSNLFTR
FT                   ELRIVKSPAELRKIRKAAYLADFALIRTLKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSTIERQLTLEHAGVYKHYHACLMRTVHIGGVTALARRMFE
FT                   VNILQMEAAMAALKPGCAIEEVFEAYARVADENGFKDQRFNACGYSLGATFAPTWMDFP
FT                   MFVRGQKVIAQPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVSLSKLPFHITRKQT
FT                   IAAWKKVKKEDYGFTAEEEDKGENLRDVELSDGDVDAEDYDVEYDFSEYQPSAPPGDPT
FT                   QLV"
     atggccatct tgaagaagcc ccaaccgttc aaaaaggcac ttcatttctc cgaaaaagag        60
     tttgaggagc gacagcaacg cgctctcaaa ctcatgaagc aagagggact cgatggcttc       120
     ctcattacga aacaagaaac tctttactac ctcactggat atgacacttt cggatacgtc       180
     ttcttccaag ccatgtactt ccacaaggat ggctcaaaga agttggtaac gcgtatgcca       240
     gatcttcgac aggctctcta cacctctgtc ttgacataca acgatatcat gatacgatcg       300
     gatgatgccg acagcaaccc ggtgtctttg gtgccacttg ttctgaaaga attcggcatc       360
     aactcgtcat ctaaacgcat cggctatgag cccaactctg caactttgac cctcgaggtt       420
     ggaaaattgc ttgaggagtc tgtggctggt ttgtgcacct tggtcaacca tagcaacttg       480
     ttcacccgcg aactacggat tgtcaaatcc ccagctgaac tacgcaagat tcgcaaggca       540
     gcctacctcg ctgatttcgc acttatcaga acgttgaaac tggctaagcc tggagcatac       600
     gagggagacc tatggcggga aatcgtcggg acagtttacg aaggtggtgg cgatgatccc       660
     gcaaatgaaa acattctcgt ctcggggaac aaggctgtcc tgactcgcta ttcggccggg       720
     aaatcaacta tcgaacgcca actcaccttg gaacatgctg gggtctacaa gcactaccac       780
     gcctgcctca tgcgaaccgt ccatatcggt ggtgttactg cactagcccg acgaatgttt       840
     gaagtcaata tcctgcagat ggaagccgcg atggctgcat tgaagcccgg ctgcgcaatt       900
     gaggaagtat ttgaagcgta cgcgagagtg gcagatgaga acggattcaa agaccaacga       960
     tttaatgcct gtggctacag tttaggcgct acttttgccc ctacctggat ggacttcccc      1020
     atgtttgtcc gaggccagaa ggtaattgca cagccaggaa tggtgttttt catccatatt      1080
     atccttatgg acaaggccac cgatacggcc agctccattg gtcaaactgt cgaagttacg      1140
     caggacgggt gcgtctcgct ctccaagttg ccgttccata ttactcggaa acagaccatc      1200
     gctgcttgga agaaggtgaa gaaggaagac tatggattca cggcagagga agaggataag      1260
     ggcgagaacc ttcgggatgt ggaactctct gatggcgatg tcgacgctga ggactatgat      1320
     gttgagtatg acttttccga atatcagcct tcggctcccc ctggggaccc gactcagctt      1380
     gtctag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page