(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE332

PENCW_10.PE332       Location/Qualifiers
FT   CDS_pept        complement(772327..773511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978321"
FT                   /orf_name="Pc13g03320"
FT                   /product="Pc13g03320 protein"
FT                   /EC_number="4.3.1.19"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="metal ion binding"
FT                   /function="metallopeptidase activity"
FT                   /function="succinyl-diaminopimelate desuccinylase activity "
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91401.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0009014"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI0001830444"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1W9"
FT                   /transl_table=1
FT                   /translation="MDGLQYTTKHDVTIDDVVSLTQTMVQIDSSTPGSGSNTAGETTVA
FT                   QYICAWLQHRNIECHWIEETPGRPSVIGVVRGSGDGKSLMFNGHTDTVTLQGYDGDPLS
FT                   GHIANGRLYGRGSADMKSGMAAAMIATASAAKLNLRGDVILAAVADEECDSIGTEQVLA
FT                   AGWRADAAIVAEPTDFAIINAHKGYVLLEVDIHGIAAHGSRPDLGVDAICKAGYFLVEL
FT                   DRYSQSLPQRSPTGVEIDAPNVHVGIIRGGAEINSYPAKCTISIERRTVAGETATSVEN
FT                   ELRPILQKLASTVSDFTFELRTTCYRPPYSIASDHPFVNLVVEHAVKSTGMAPPIKSET
FT                   YWTDMALLSEAGIPGVIWGPKGCGLHSKEESVEVESIRQLADSFIAIAASYCQG"
     atggacggtc tccagtatac taccaagcac gacgttacca ttgacgacgt cgtctcccta        60
     actcagacca tggtgcagat cgactcctcg acccccgggt ccggttcaaa tacagccggc       120
     gagacgaccg ttgcgcagta tatatgcgca tggctccaac accgcaacat cgaatgccac       180
     tggattgaag agaccccagg gcgtccatca gtcattggtg tcgtccgagg atcgggagat       240
     ggaaagtctc ttatgttcaa cggacacacc gataccgtca ctctccaagg ttatgacggg       300
     gacccgttaa gcggccatat agccaacggc aggctctacg gacgcggatc agccgacatg       360
     aaaagtggca tggcagcagc aatgattgca actgccagtg ctgccaaatt gaatctccga       420
     ggtgatgtga tcctcgcggc cgtggcggat gaagaatgcg atagtatcgg tacagaacaa       480
     gtgctggcgg ccggttggcg ggcagatgct gctattgttg cagagccaac tgacttcgcc       540
     atcattaacg cccataaagg atacgttctc ctagaggttg acatccacgg tattgccgcc       600
     catggctctc gtccagacct cggtgttgat gccatctgca aggccggata cttcctcgtc       660
     gaactggatc gctactctca gagtcttccg caacgttctc ctaccggagt cgaaatagac       720
     gccccaaacg tccatgtagg cattatcaga ggcggcgccg aaatcaactc ctaccctgcc       780
     aaatgcacaa tctctatcga gcggcgcacc gttgcaggcg agaccgcgac atctgtggaa       840
     aatgagctgc gacccattct acaaaagctc gcatcaacgg tttctgattt tacctttgag       900
     cttcgcacga catgttaccg gcccccttac tcgattgcgt ctgatcatcc ctttgtcaat       960
     cttgtcgttg aacacgctgt aaaatcaacg ggcatggcac cgccgattaa gagcgagact      1020
     tattggaccg acatggcgtt gctttctgaa gcagggattc cgggcgtgat ctgggggccg      1080
     aagggctgtg gattgcattc gaaggaggaa tcggttgagg ttgaatctat tcgccaactt      1140
     gcagactcat ttatagcaat cgcggcgagc tattgtcagg gttga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page