(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE335

PENCW_10.PE335       Location/Qualifiers
FT   CDS_pept        join(778711..778752,778832..779263,779315..780871)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950861"
FT                   /orf_name="Pc13g03350"
FT                   /product="Pc13g03350 protein"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91404.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI0001830447"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y2"
FT                   /transl_table=1
FT                   /translation="MHPFDPLSPAEISEVTAIVRTHFPGQLPVFRFITLKEPAKLEMLP
FT                   FLENEHRGLPNITRPARTSRVQVVMRSDKGENQLIELLVDLDNKRVIKNEHLVGRHSYI
FT                   DADYMRLVESACLADPKVQDEIKKLKLPANSTVIVEPWAYGTDGINDMSERISMCWFYL
FT                   RLLDNPDANYYAYPLDLCAEVSEELKVTKIYYLPSSQEERISDQARPFDINRIHSTVDS
FT                   EYHPSLRPPPRNTTKPYQVVQPEGPSFSTQGNRISWEKWTMRVGFNYREGLTLHDIRYD
FT                   GRSLFYRLSLAEMFVPYGDPRAPYPRKAAFDLGSDGAGVNANNLRLGCDCLGLIKYFDA
FT                   WHNTSSGEPLKLPNVVCCHEQDDGILWKHTNFRTQNAVVARARILVLQTIITVSNYEYI
FT                   FAFQFSQDASIHYEVRATGILSTCPINIGDKVPYGTIVAPGVLAPYHQHLFCLRMDPWV
FT                   DGNVQNTLQVEESHAMPISDTNPFGVGYTTSSNNITEETGLDLDISKNRTFKIINEHSI
FT                   NPITGTPVGFKLLPSYSQMLLAHPDSYHAHRSEYAAHAVWVTRYDDEEMFPAGRHTMQS
FT                   TGGEGIHSAITRRKNDGSKTSVRNEDIVLWHTFGSTHNPRIEDWPVMPMDRMVVGIKPV
FT                   NFFTGNPGLDVPPSTQERNRSVLVNGDSDSLKSSSDTCCRL"
     atgcaccctt tcgaccccct ctctccagcc gagatctccg aggttacggc cattgttcgc        60
     actcattttc ccggacaatt gccagtattc cgattcatta ctctcaagga gcccgcaaag       120
     ctggaaatgc tgccattcct agagaatgag caccgcggcc tcccaaacat cacacgacca       180
     gcgcgcacct ctcgtgtcca ggtggtcatg cgtagcgata agggtgaaaa ccagttgatt       240
     gagcttctag tggacctgga taacaagcga gtgatcaaga acgagcatct tgtgggaaga       300
     cactcctaca ttgatgccga ctatatgcgc ctggtcgaat ccgcttgtct ggcggacccg       360
     aaagtacagg acgagattaa gaagctcaaa ctgcccgcca actcgacggt aattgtcgag       420
     ccatgggcct atggaacaga tgggataaat gacatgtcgg aaagaatttc gatgtgctgg       480
     ttctacctgc ggcttctaga taaccctgac gccaactact atgcataccc cctggacctg       540
     tgcgcagagg tgtcagagga actaaaagtc accaaaatct attatctgcc atcctcccaa       600
     gaggagcgaa ttagtgacca ggcccggcct tttgatatca accgaattca ttccacagtg       660
     gatagcgagt atcaccccag tctgcggcca ccaccgcgca acaccaccaa gccttaccag       720
     gtcgtgcagc cagaaggtcc ttcgtttagc acgcaaggga accggatttc ttgggagaaa       780
     tggactatgc gtgtgggatt caattaccgc gaaggactca cgctacatga tatccgctac       840
     gatggccgga gcctctttta ccgtctctcc cttgctgaaa tgttcgtgcc ctatggcgac       900
     ccacgcgctc cctatccacg aaaggcagcc ttcgacttgg gaagcgatgg cgcaggtgtt       960
     aatgccaaca acctgcgtct aggatgtgac tgtctcgggc tgataaagta cttcgatgcg      1020
     tggcataaca cctcttccgg agaacccctc aaactcccta acgtggtctg ctgccacgaa      1080
     caggacgacg gcatcctctg gaaacatacc aacttccgca cgcagaacgc agtagtagct      1140
     cgcgcgcgca tcctagtgct gcagactatc atcaccgtca gcaactacga atacatcttc      1200
     gccttccaat tcagtcaaga cgcgtctatc cactacgagg tccgcgcgac tggcatccta      1260
     tccacgtgcc ctatcaatat cggcgataaa gtcccctacg gcactatcgt cgcccctggc      1320
     gtcttagccc cctaccacca acacctcttc tgtctccgga tggatccctg ggtcgacgga      1380
     aacgtccaaa acaccctgca agtcgaagag tcgcacgcca tgcctatcag cgataccaat      1440
     cccttcggcg tgggatacac caccagctcg aataacataa ccgaggaaac cgggctcgac      1500
     ctcgacattt ccaaaaaccg caccttcaaa atcatcaacg agcactcaat caaccctatc      1560
     acaggaacac cggtgggctt taaactcctt ccgtcataca gccaaatgct cctcgcacac      1620
     ccggactcct accacgccca tagatccgag tacgccgcgc acgctgtctg ggttacccgg      1680
     tatgacgatg aagagatgtt ccctgctggc cggcacacga tgcagtcgac cggtggggag      1740
     gggattcatt cggcgattac gcggcgcaag aacgatggta gtaagacatc tgtccgtaat      1800
     gaggatattg tcctctggca tacgtttggg tcgactcata atccgcgcat cgaggattgg      1860
     ccggttatgc cgatggatcg gatggttgtt ggtatcaagc cggtgaactt ctttactggg      1920
     aatcccgggc tggatgttcc cccctcgacg caggagagaa atcgaagtgt gttggttaat      1980
     ggcgattcgg attctctgaa gtcatcatcg gatacttgtt gtcggttgtg a               2031
//

If you have problems or comments...

PBIL Back to PBIL home page