(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE336

PENCW_10.PE336       Location/Qualifiers
FT   CDS_pept        join(complement(782581..782683),complement(782413..782513),
FT                   complement(782208..782335),complement(781313..782156))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950862"
FT                   /orf_name="Pc13g03360"
FT                   /product="Pc13g03360 protein"
FT                   /protein_id="CAP91405.1"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniParc:UPI0001830448"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y3"
FT                   /transl_table=1
FT                   /translation="MASNIPAGLRSADIGRFAIRATQIEKAKPVVAYWCNFHIVNQIIE
FT                   RGLHNTDDEIKLYTTNLVDKLEQFKLENPDNDTVTDTVAASAYVEQFGLEVFSRAEAAM
FT                   DANKVTKQTADTFQAAATFLELCSIWGPLDPEIAGRIKFAKFHAVRIVKAFKAGEDPNA
FT                   TNPAPKQEEEPVDDPDVQAFDESVAEQASKPRQASIEEVPDESDRFARELARKSTVDES
FT                   LHPSRTSSTPRPPPEIPSVPRNAPGAPPQSMDVDESNTGGLNLPSTPAAIGASSSVPKL
FT                   PDTPTAFQSFPPPSEGPSVSTPDPASFYDTPGASAPIPPPTAPAFVPTPAANVPVAPSP
FT                   YVPPQPSHGLDDNTVQMAQKHARWAVSALTFDDVDTAIKELRSSLKCLGAS"
     atggcgagta acataccagc tggactccga tccgcagaca tcgggcgatt tgcaatcaga        60
     gccactcaga tcgagaaggc taaacctgtg gttgcctact ggtgcaattt ccatattgta       120
     aaccagatta ttgaaagggg tttgcacaat accgatgacg agatcaaact ctacacgaca       180
     aacctcgtgg acaagctgga gcagttcaaa ttagagaacc cagacaatga cacagtgaca       240
     gacactgttg cagcgagcgc ctatgtcgag caattcggat tggaggtctt cagccgtgcc       300
     gaggccgcta tggatgccaa caaagtcaca aagcaaacgg cagatacttt ccaggcagca       360
     gctacattcc ttgaactttg ttcgatctgg gggcccctag acccagaaat tgcggggcgg       420
     atcaaattcg ccaaattcca cgcagtccgg attgtcaagg ctttcaaagc cggcgaagac       480
     cccaacgcga caaatcccgc acctaagcag gaagaagaac ctgtcgacga ccccgacgtt       540
     caggcatttg atgagtcggt agcagagcag gcctccaagc caagacaagc ctctatcgaa       600
     gaggtcccag acgagtccga ccgttttgca agggagcttg ctcggaaatc gactgtcgac       660
     gaatcgctcc atccatcacg tacatcgtca acacctcgtc ccccacccga gatcccttct       720
     gttcctcgca acgcacccgg tgctcctccg caatcgatgg atgtcgatga atccaacaca       780
     ggcggcttaa atctcccatc aactccagcg gctattggcg cttcgtcctc agtacctaag       840
     cttccagata ccccgactgc tttccagtcc ttccctccgc catccgaggg tccgtccgtc       900
     tctacgccag acccggcttc tttctacgat accccaggtg ctagcgctcc tatcccgcct       960
     ccgactgccc cggcatttgt tccgacccca gctgctaatg tgccggttgc gccatctcct      1020
     tatgtccctc cccaaccatc acatggtcta gacgataata ctgtgcagat ggcgcagaag      1080
     catgcccgtt gggcggtctc cgctttgact ttcgatgatg tcgatactgc tattaaggaa      1140
     ctcagaagct cgctgaagtg tctaggcgca tcatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page