(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE337

PENCW_10.PE337       Location/Qualifiers
FT   CDS_pept        join(complement(785542..785586),complement(785118..785488),
FT                   complement(784837..785068),complement(782880..784784))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825155"
FT                   /orf_name="Pc13g03370"
FT                   /product="Pc13g03370 protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91406.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI0001830449"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y4"
FT                   /transl_table=1
FT                   /translation="MSRPASTQSLISQARSAEEAIAAATSKKAALEAAINAAEHYMKAL
FT                   RLAPADDKKLLDAKCKELISKAEKIKAATDWQSAARAGPQKAFPSLRPPASTRKLTTRE
FT                   EIIILEGAKLNGYIFPPWSRAPPQDEFVYKGQLFTDTPDLHLSECQREIFAGWKRPHDL
FT                   LQTMNTAKQPYDIINPAMSASGETDLVQDVLTDCSVVASLCATTARSERGLGQHASPTL
FT                   YPCSEDKNPILSHSGKYIFRFYFNGSFRKVVIDDRLPSSKTTRSLHVIDRNNSNFLWPA
FT                   LVEKAYLKVRGGYDFPGSNSGTDLWVLTGWIPEQVFLHHDDSTSDEIWGRLYSAFWHGD
FT                   VVLTIGTGKLTELEQQGLGLVSEHDYAILDLKEVQGRRQFLLKNPWAGAEPHIQSSLTA
FT                   DLGSLGLNDKPPLSPGTFWMDCEQVLQNFENLYLNWNPGLFKYREDIHFTWDLSHGRVI
FT                   AGCFVKNPQFSISSDSGGTVWLLLGKHFKTDHQEFDTGESENETGFISIYIFQADGRRV
FT                   SLSDGALHRGPYVDSPNTLMRLEMPPKSTYTAVVSEQSLPSSAQNFTLSAFSTAPVAVA
FT                   PSLDKYLCLTKASGSWTAMTAGGNAESPRYHSNPQFSIRISEPTDVSILLETTEAELAT
FT                   HVKIFWSNGQRVSRVRSRDIIADSGDYRRGCALAETKSLDKGTYTIVCSTFAPDQFGRF
FT                   TLWISSTIPCVVQPLVSESAGRRAVLSEVGVLSPGKDRMLASLRVSRLTRIRLIARNKR
FT                   STVGLRAVAPSPVLMTVELGQGPYKEILATSEDGAHSDAASGVRVEDFDLLPSAESRRV
FT                   WIVIERIGGPGGQVEDHFEVEALAEERVEIGKWVIEDE"
     atgtctagac ctgcatccac acaatccctt atatctcaag cacggagcgc tgaagaggcg        60
     atagccgcag cgacctccaa gaaagcggca ttggaggcag ctatcaatgc cgccgagcat       120
     tacatgaaag cgctgcgcct ggcgcccgcc gacgacaaaa agctactaga cgccaaatgc       180
     aaggaattga tatccaaagc tgagaagatc aaggccgcca ctgactggca gtcggctgct       240
     cgtgcggggc cccagaaagc cttccctagc ctacggccgc cggcatccac gcggaagctc       300
     accacccgtg aagagatcat catccttgag ggtgccaaac tcaacggtta tatctttcca       360
     ccatggagtc gcgcaccgcc tcaggatgaa tttgtatata aagggcagct ttttacggat       420
     acgcctgatt tacacctctc tgaatgccag agggaaattt tcgcaggctg gaaacggcca       480
     catgatctgt tgcagacaat gaatacggcc aagcagccgt atgatataat taatccagct       540
     atgtcggctt cgggggaaac agacctcgtg caggatgtct taacagattg ttcagtcgtc       600
     gcaagccttt gcgccacaac tgctcgatcg gaacgaggtc tagggcagca tgcatcaccg       660
     acactgtacc catgcagtga ggataagaac ccaatacttt cgcattctgg gaagtacata       720
     tttcgcttct acttcaatgg gtctttccgg aaggtagtga tagatgatcg gttgccatca       780
     tcgaagacta cacgctcact tcatgtgatc gatcgcaaca actcgaactt tttgtggcct       840
     gctcttgtgg agaaggccta cttgaaggtc cgtggaggct atgatttccc aggaagtaac       900
     tcagggaccg acctttgggt gcttactggt tggattccgg aacaagtctt tttacatcac       960
     gacgattcga cctctgatga gatctggggg cgtttataca gcgccttctg gcatggtgat      1020
     gtggttttaa ctatcggtac tgggaaattg actgaactgg aacaacaagg actggggcta      1080
     gttagcgagc acgactatgc tatcctggac ctgaaggaag tccagggtcg tcgtcagttt      1140
     cttttgaaga acccgtgggc cggtgcagaa ccccatatac aaagcagtct tacggcagat      1200
     ctcggctcac tcggcctgaa tgataaacct cccctttcgc caggcacgtt ttggatggac      1260
     tgtgaacaag ttcttcaaaa tttcgagaac ctgtacctta actggaatcc tggtttgttc      1320
     aaataccggg aggacataca cttcacttgg gatttgtcgc atggtcgagt tatcgctggt      1380
     tgcttcgtga agaacccaca attttccatc tccagtgatt caggaggaac ggtctggctg      1440
     cttctcggga agcattttaa gaccgaccat caagagttcg atactgggga atcggaaaat      1500
     gaaacaggct ttatcagcat ctacatcttc caagcagatg gccgaagagt gtctctcagt      1560
     gatggcgcgc tccaccgcgg accatacgtg gactctccca acacgcttat gaggctggaa      1620
     atgcctccca agtcgaccta caccgcagtg gtctcagagc aatcactccc gtcatccgcc      1680
     cagaatttca cactttctgc gttttcaact gcccctgtgg ctgtggcacc ctcgctagat      1740
     aaatatctat gcttgaccaa ggcaagtggt tcctggacag caatgacagc aggcgggaat      1800
     gccgagtccc ctcggtacca ctccaatcca caattcagca tacgaatttc cgaaccgaca      1860
     gacgtttcca tattgctcga gaccactgaa gcggagctag cgactcatgt gaaaatcttc      1920
     tggtcaaacg ggcagcgcgt atcacgtgtg cgaagccgag acatcattgc agatagcggc      1980
     gattaccgtc gtgggtgcgc actggccgaa accaaatctc tggacaaagg cacctatacc      2040
     atcgtctgct ccacatttgc acctgaccag tttggccgct tcacgttatg gatttcctcc      2100
     acgatcccct gtgtagtcca gcccttggtt tccgagtctg ctgggcggcg cgccgtccta      2160
     tccgaagtgg gcgttttgtc tccgggcaag gaccggatgc tggcctccct gcgggtctcc      2220
     cgtttgacgc ggatccgact tattgcgagg aataagcggt ccacggtcgg cttgcgtgct      2280
     gttgctccgt ctcctgtact gatgactgtg gagctgggcc aggggccata caaggagata      2340
     ctagctacct cggaggatgg agctcatagc gatgctgcgt ctggggtacg tgttgaagac      2400
     ttcgatttgt tacccagtgc cgaatcacgt cgtgtgtgga ttgttattga gcgcattggg      2460
     ggtccgggag ggcaggtgga ggatcatttt gaagtggaag cattagcaga ggaaagagtg      2520
     gagattggaa agtgggtgat tgaagatgaa tga                                   2553
//

If you have problems or comments...

PBIL Back to PBIL home page