(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE338

PENCW_10.PE338       Location/Qualifiers
FT   CDS_pept        join(786153..786253,786317..786861,786915..787152,
FT                   787203..787326)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129521"
FT                   /orf_name="Pc13g03380"
FT                   /product="Pc13g03380 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP91407.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000183044A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y5"
FT                   /transl_table=1
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANAMVYPLDLVKTKLQVQVKE
FT                   KNGTVRPDNLEHYESTMDAITKIVEKEGYNGLYSGMAGALLGVASTNFAYFYWYSVVRT
FT                   LYMASAKPTQAPGTAIELSLGAVSGAVAQLFTIPVAVITTRQQTQPKGEKKGLIETGRE
FT                   VVDSEDGWSGLWRGLKASLILVVNPAITYGAYQRLKDVIFPGKNNLKPWEAFLLGAMSK
FT                   ALATIATQPLIVAKVGLQSRPPPSRNGKPFKTFGEVMKHIVDNEGLFSLFKGIGPQILK
FT                   GLLVQGLLMMTKERMELLFIVLFAYLKNIKKDKLRKAVDAAAEKAKTSMPATLK"
     atggccggtc aatccaaacc tgcgctgtcg ccatggggca gcgccgtggc aggcgcgact        60
     ggtgccgtcc ttgcaaacgc gatggtgtac ccacttgact tagtcaagac gaaactacaa       120
     gtacaagtca aagaaaagaa cggaaccgtg cggcccgata acctcgaaca ttatgaatcg       180
     accatggatg ctatcaccaa gatcgtggag aaggagggct ataatggtct gtactcggga       240
     atggctggag cccttctagg cgtcgcctca acaaacttcg catacttcta ttggtacagc       300
     gtcgtaagaa cgctctacat ggcttctgcc aagccgacac aggcccccgg caccgcaatt       360
     gagctctccc tgggcgccgt ctccggcgcc gtggctcagc ttttcactat cccggtggcc       420
     gttatcacaa cccgacagca gacacagccg aagggcgaga agaaggggtt gatcgagacg       480
     ggtcgggaag tggtcgacag cgaggacggc tggagcggcc tgtggcgcgg cctgaaggct       540
     agcttgatcc tggtcgttaa cccggccatc acctatggcg cataccagcg tctaaaggat       600
     gttatcttcc cagggaagaa caacctcaag ccctgggagg ctttcctgct tggtgccatg       660
     tccaaggctt tggccacgat cgcaacccag cctctgattg tcgccaaggt tggactgcag       720
     tctcgcccac cgccgagccg gaatggcaag cccttcaaga cctttggtga ggtcatgaaa       780
     cacattgttg ataatgaggg tctcttttcc ctcttcaagg gtatcggacc tcagattctg       840
     aaaggtcttt tggtccaagg tctgctcatg atgaccaagg agaggatgga gctccttttc       900
     atcgtcctgt tcgcctacct caagaacatc aagaaggaca aattgcgcaa ggcagtggat       960
     gctgcagctg aaaaggccaa gaccagcatg cctgctaccc tgaaataa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page