(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE34

PENCW_10.PE34        Location/Qualifiers
FT   CDS_pept        join(complement(81729..81949),complement(81557..81660),
FT                   complement(81382..81401))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948692"
FT                   /orf_name="Pc13g00340"
FT                   /product="Putative uncharacterized protein Pc13g00340 "
FT                   /protein_id="CAP91103.1"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI0001830DC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H179"
FT                   /transl_table=1
FT                   /translation="MRLGFLLSLFLNVVIARAGLSPVRTVCEFDWSLCQASNNGEMTCF
FT                   CDSDKQNQSTIDLNDCFVNLDGDLSPRQNGGFMDSCGELSFMPALPTLRATCKPNNQIT
FT                   SINMGPDLKL"
     atgcggttgg gatttctctt gtcacttttt ctgaatgttg tcatcgcccg agctggactc        60
     tccccagtgc ggacggtctg tgaatttgat tggagcctct gccaagccag taataacggc       120
     gaaatgacct gtttctgtga tagcgacaaa cagaaccaga gcactatcga tttgaatgac       180
     tgctttgtta atcttgatgg agatctgagc ccacgccaaa atggtggatt catggattca       240
     tgtggtgaat taagtttcat gcccgcgctc ccaaccttgc gggcaacctg caaaccaaac       300
     aatcaaatca cgtctatcaa tatgggacca gacttgaagc tatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page