(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE340

PENCW_10.PE340       Location/Qualifiers
FT   CDS_pept        join(complement(790558..791167),complement(790311..790504))
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15950863"
FT                   /orf_name="Pc13g03400"
FT                   /product="Pc13g03400 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91409.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183044B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z1"
FT                   /transl_table=1
FT                   /translation="MSSYAITGASKGIGREFVRQLAADTTNTVLAIVRDPESPYISELA
FT                   SKHHNVHVIKGDVTDPKSILEAASAAAAITGGKLDVLIHNSNAVDMATMSFNPTEIPFD
FT                   AQAVRAIFDPPLSTGIYGSLWTTNAFLPLIEKGIQKKIVHISSAMADLDLINKTGVSYA
FT                   VAYSVAKAGMNVQVAKYAAELGPRGIKVLALSPGWVDTWEGEKPSQVVEAEKVMLKQFQ
FT                   AAEPELKGQIQPEESVRKCLQVIERLDAETSGLLLSHNGDKQRWL"
     atgtcttcat atgccatcac tggagcctcc aagggcattg gccgcgagtt cgtgcgccaa        60
     ctcgctgccg ataccaccaa cacggtcctg gctattgtgc gagatcccga atcaccttat       120
     atatctgagc tcgcctccaa gcaccataac gtgcacgtta tcaaaggcga tgttacagac       180
     ccaaagtcca tcctcgaggc tgcctcggcc gcagctgcca tcacaggtgg taagctagac       240
     gtgcttattc acaactccaa cgccgtcgat atggccacca tgtccttcaa cccgaccgag       300
     atccccttcg atgctcaagc tgttcgagca atttttgacc cgccgctcag taccggcatc       360
     tacggcagtc tatggacgac taacgccttc cttcccctga ttgagaaggg catccagaag       420
     aagattgtgc acatctccag cgccatggca gatttggatc ttatcaataa gactggtgtc       480
     agttatgctg ttgcgtactc tgttgcaaag gccgggatga acgtccaagt cgccaagtac       540
     gcagcagaac ttgggcctag gggcatcaag gtgttggctt taagccctgg atgggttgat       600
     acgtgggagg gagagaaacc ctctcaggta gtagaagcgg aaaaggtcat gctgaagcag       660
     tttcaggcag ctgagcctga actcaaaggg cagatccagc ctgaggagag cgttagaaag       720
     tgcctccaag tgattgagcg tctggatgcc gagacgagcg gtttgcttct gagccataat       780
     ggggacaagc aaaggtggtt gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page