(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE342

PENCW_10.PE342       Location/Qualifiers
FT   CDS_pept        join(794204..794350,794405..794412,794448..795810)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950864"
FT                   /orf_name="Pc13g03420"
FT                   /product="Pc13g03420 protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP91411.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000183044D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z3"
FT                   /transl_table=1
FT                   /translation="MLHSASLLLVSLLAALPVNADGLYTKNSPVIQLNPKTYNSLIANS
FT                   NYTSIVDSLPPQPSLTHPLRFYAPWCGHCKNLKPAYEKAAKNLDGLAKVAAINCDDDEN
FT                   KPFCGQMGVQGFPTLKIVTPSKKPGKPRVEDYQGARSAKGIVDAVVDRIPNHVKRATDK
FT                   DLDKWLGQNEDRPKAILFTEKGTTGALIRALAVDFLGAIDIAQVRNKESASVKKFDVTE
FT                   FPTLVLIPSADAEPKIYAGDLKKKPITEFLSQAAAPNPDASPRSASNSKPKQKSKPASK
FT                   PTSVVDDAEDLKPTASQDQDETDPSEKPVQVPIPAPPIPTLATPESVESACLTPKSGTC
FT                   VLVILPETSEPDAALPAHATEALASVAEIGHKHALRGTHLFPLYAVPAINTASKTLREA
FT                   LELADGQTVEIIALNARRGWWRRFSGADADFGAVAVESWVDAIRLGDGTKEKLPEGIVV
FT                   SVEAETESEAEVKPEAEAEVEPEAETVEAEAETKAETEEQAAEHDEL"
     atgctgcaca gcgccagcct cttgcttgtg tcgctccttg cggcactgcc tgttaacgcc        60
     gatggactat acaccaagaa ttcgccggtg atccagttaa atcccaaaac ttacaactcg       120
     ctcattgcaa actcgaacta tacctcgatc gtcgactctc tgcctcccca accttcactc       180
     acacacccac ttagattcta cgcgccctgg tgcggccatt gcaagaacct caaacctgcc       240
     tacgaaaaag ccgcgaaaaa cctcgacgga ctcgcgaaag tcgccgcgat caactgcgac       300
     gatgacgaaa ataaaccctt ctgcgggcag atgggtgtcc agggcttccc cacactgaaa       360
     atcgtgacac cctcgaaaaa gcccggaaag cctcgcgtcg aggactacca aggcgcgcgc       420
     agcgccaaag gtatcgtcga cgccgtcgtc gaccgcatcc ccaaccacgt gaagcgcgca       480
     acagacaagg acctggacaa atggcttgga caaaacgaag accgacccaa ggccatcttg       540
     ttcaccgaga agggcacaac aggcgcgctg atccgcgccc tggcagtcga cttcctcggc       600
     gcgattgaca tcgcccaagt ccggaacaag gaatccgcct ctgtgaagaa gttcgacgta       660
     accgagttcc cgacactcgt cctcatcccc agcgccgacg ccgagcccaa gatctacgcc       720
     ggcgacctga agaagaaacc catcaccgag ttcctcagcc aagcggcagc accaaaccca       780
     gacgcctcac cccgctccgc ctccaactcc aagccgaaac aaaagtccaa gcctgcttcc       840
     aagcctacct ccgtcgtcga cgacgccgaa gacctcaagc ccaccgcctc ccaggaccag       900
     gacgaaacag atccgtcgga gaagcccgtt caggttccca tccccgcacc cccaatccca       960
     accctcgcca cccccgaatc cgtcgagtca gcctgcctaa caccaaagtc cggcacctgt      1020
     gtgctagtca tcctccccga gacgagcgag ccggatgctg cgcttccagc gcatgccacc      1080
     gaggcactcg cgagcgtcgc tgagatcgga cacaagcacg ctctgcgcgg aacgcatctc      1140
     ttcccgctgt acgctgttcc tgccatcaac actgcgtcta agactctgcg tgaggcattg      1200
     gaattggctg atggccagac ggttgagatt atcgctttga atgcgcgtcg tggatggtgg      1260
     cgtcggttca gcggtgccga tgcggacttc ggggctgttg ctgttgagtc ttgggttgat      1320
     gcgattcgct tgggtgacgg gactaaggag aagttgcctg agggcattgt tgtcagtgtt      1380
     gaggctgaga ctgaatccga ggctgaggtt aagcctgagg cggaagctga ggttgagcct      1440
     gaagctgaga cggtcgaggc tgaggctgaa accaaggctg agactgaaga acaggccgcg      1500
     gagcatgatg agctgtga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page