(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE343

PENCW_10.PE343       Location/Qualifiers
FT   CDS_pept        join(complement(796333..799307),complement(796139..796271))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950865"
FT                   /orf_name="Pc13g03430"
FT                   /product="Pc13g03430 protein"
FT                   /protein_id="CAP91412.1"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="UniParc:UPI000183050F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z4"
FT                   /transl_table=1
FT                   /translation="MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDHAKDVIVHLHYIMS
FT                   SVDVKQNKSVLWAYKKDLLGFTSHRKKREMKIKKEVKRGIREPNQEDPFELFITLNQIR
FT                   YVYYKETEKILGNTYGMCVLQDFEAMTPNLLARTVETVEGGGLVILLLKSMTSLKQLYT
FT                   MSMDIHSRYRTEAHDDVVARFNERFILSLGSCDSCLVVDDELNVLPISGGKSVKPLPAP
FT                   ETTDESASGTKKELKEIKESLADSKPVGPLLSLARTVDQAKALLTFVDAIAEKTLKSTV
FT                   TLTAGRGRGKSAALGVAIAAAVAHGYSNIFITSPSPENLKTLFEFIFKGFDALGYLDHV
FT                   DYTILQSTNPDFNKAVVRVNIHRNHRQTIQYIQPQDAQVLGQAELLVIDEAAAIPLPLV
FT                   RKLMGPYLVFMSSTINGYEGTGRSLSLKLIQQLREQSRTGVKTDDTDIADRSTGKSAKG
FT                   ADKNLSGRTLREITLSEPIRYAPGDSVEKWLNKVLCLDATLPKSHMNTQGCPHPSQCQL
FT                   LQVNRDTLFSFHPVSEKFLQQMMALYVASHYKNTPNDLQLMSDAPAHQLYVLVPPIDEG
FT                   ATKLPEPLCVIQVALEGRISRQSVLNSLSRGQRAGGDLIPWLVSQQFQDENFASLSGAR
FT                   IVRIATNPEYVGMGYGSRAMQLLVDFFEGKFTNLEEENIAAEEQMVRVTDEELASSSLL
FT                   DDNVHVRDIRSMPPLFGKLTERRPDVLDYVGVSYGLTPSLHKFWKRGSFVPVYLRQTPN
FT                   ELTGEHSCVMVRTLSTGEADDAWLSAYARDFHKRFLSLMSYQFGQFPSVLSLSICEAAN
FT                   SGAKKDPTFKPRTLQKADLDAAFSPFDLKRLDSYANNLLDYHVILDLVPALSDYYFANR
FT                   LDGKVSLSGVQQSILLAIGLQHKSLDDLEKELNLPSSQLLAMFLKIVRKVSTHFRNLIE
FT                   NEIEQSLPAQKVRVETSAAHDDEPEVNLQPLPISLEDELREGSKKIDEEMLAKQRALSA
FT                   ANPDGPDGSKSSKRKKIETARDIYDKEIDSKRQKMIKKGTEGRKKR"
     atgcctcgca aggcgattga ctcgcggatt cccgctctta ttcgaaatgg cgtgcaggag        60
     aagaagcgca gcttcttcgt ggttgttggt gaccatgcca aggatgtgat cgtgcatctt       120
     cactatatca tgtccagcgt ggacgtgaag cagaacaagt ctgtactatg ggcttacaag       180
     aaggacctgc tcggctttac gagtcaccga aagaagcgcg aaatgaagat caagaaggag       240
     gtcaagcgtg gcattcgtga acccaaccag gaagacccat tcgaactttt catcaccctc       300
     aaccagatcc gctatgtcta ctacaaggaa accgagaaga ttttgggtaa cacttacggc       360
     atgtgtgtgt tgcaggactt cgaggccatg actcccaatt tgcttgcgcg aaccgtcgag       420
     accgtcgagg gtggaggttt ggtgatcttg cttttgaaga gcatgaccag tctgaagcag       480
     ctctacacca tgtccatgga tattcactcg cgataccgca cagaggcgca tgatgatgtt       540
     gtggctcgtt tcaacgagcg attcattctg tccctcggaa gctgcgattc gtgcctggtg       600
     gtcgacgacg agctgaacgt gttgcccatc tccggcggca agagtgtgaa gcccctcccc       660
     gcccccgaaa caaccgacga gtcagcttcc ggcaccaaga aggaattgaa ggaaatcaag       720
     gagagtttgg ccgactccaa gcccgtcggg cctctgctga gcttggcccg caccgtggat       780
     caagcgaagg ccctcctgac ttttgttgat gcaattgccg aaaagacttt gaagagcacg       840
     gttacactga ctgctggtcg tggacgagga aagtccgccg ctctcggtgt cgccattgcc       900
     gcggctgtcg ctcacggcta cagcaacatc ttcattactt ctcctagccc ggagaacttg       960
     aagacactct tcgaattcat tttcaagggc ttcgatgcac ttggatatct cgaccatgtc      1020
     gactacacca tcctgcagtc gaccaaccct gacttcaaca aggccgttgt gcgtgtgaac      1080
     attcaccgca accaccgtca aaccatccag tacattcagc cccaggacgc gcaagttttg      1140
     ggacaggcag agctcctcgt tattgatgag gctgcagcta tccctctccc attggtgcgc      1200
     aagctgatgg gaccttacct ggtgttcatg tcctccacca ttaatggata cgaaggcacg      1260
     ggccggtccc tgtctctgaa gttgatccag caactgcggg aacaatcccg aactggagtc      1320
     aagacagacg ataccgacat cgccgaccgc agcacaggca agtcagccaa gggtgccgac      1380
     aagaacctca gcggccgaac gttgagggag atcactctct cggagcccat tcggtatgcc      1440
     ccaggtgatt ctgtcgagaa atggctgaac aaggtcctct gccttgacgc aactcttccc      1500
     aagtcgcaca tgaacacaca aggctgccct cacccctcgc agtgccagct gcttcaggtc      1560
     aaccgtgata ccctgttctc cttccaccct gtctccgaga agttcttgca gcagatgatg      1620
     gcgctctacg ttgccagtca ctacaagaac acacccaacg accttcagct tatgagtgac      1680
     gctcctgctc atcaactcta tgtcctcgtc ccgcctattg atgagggggc caccaagctc      1740
     cccgagccac tttgcgttat tcaggtcgcc cttgaaggtc gtatcagtcg ccagagtgtg      1800
     cttaacagtt tgagccgtgg tcagcgcgcg ggaggtgatc tcatcccctg gttggtcagc      1860
     cagcagttcc aagatgaaaa cttcgccagt ctctcaggtg ctcgtattgt ccgtatcgca      1920
     acgaaccccg aatatgtggg tatgggatac ggttcccggg ctatgcagct tctggttgac      1980
     ttcttcgagg gcaagttcac caacttggag gaggagaaca ttgccgccga agagcaaatg      2040
     gtccgtgtta cggacgaaga gctcgccagc tctagcctct tggatgacaa tgtccacgtc      2100
     cgagacattc gctccatgcc tccgctgttc ggcaagctga ccgaacgtcg ccctgatgtc      2160
     ctcgactacg tcggcgtcag ctacggtctt accccatccc ttcacaagtt ctggaaacgc      2220
     ggttctttcg tcccggtgta tctgcgccag acccctaacg aactcactgg agagcactct      2280
     tgcgtgatgg tccgcaccct ctccaccggc gaggcagacg atgcctggct aagcgcctac      2340
     gcgcgcgact tccacaagcg attcctctcg ctgatgtcct accaattcgg ccaattccca      2400
     tccgtcctct ccctcagcat atgcgaggcc gccaactccg gtgccaagaa ggacccgacg      2460
     ttcaagccgc gcacactgca aaaagccgac cttgatgccg ccttctcgcc cttcgatctc      2520
     aagcgtctgg acagctacgc caacaacctc ttggactacc acgttatcct ggatctcgtc      2580
     cccgcactct ccgactacta ctttgccaac cgtctcgatg gcaaggtcag cctctcgggc      2640
     gtgcagcaat ccatcctcct cgccatcggc ctgcagcaca agagcctcga cgacctcgag      2700
     aaggagctga acctcccctc ctcccagctc ctcgccatgt tcctcaagat tgtccgcaag      2760
     gtctccaccc acttccgcaa tctcatcgag aacgagatcg agcaatctct gcccgcacag      2820
     aaggttcgtg tcgagacctc tgccgctcac gacgacgagc ccgaagtcaa cctccagccc      2880
     ctgccaatca gtctcgagga tgagctccgc gaaggaagca agaagatcga tgaggagatg      2940
     ctcgccaagc agcgtgctct gagcgcagct aaccctgatg gacctgatgg ctctaagtct      3000
     tccaagcgca agaagatcga gactgcgcgg gatatctacg ataaggagat tgactcgaag      3060
     aggcaaaaga tgatcaagaa gggcaccgag ggccgcaaaa agcgctga                   3108
//

If you have problems or comments...

PBIL Back to PBIL home page