(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE344

PENCW_10.PE344       Location/Qualifiers
FT   CDS_pept        join(800677..800720,800787..800845,800908..801227,
FT                   801292..801705,801760..801912,801967..802391,8
FT                   02443..804015)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950866"
FT                   /orf_name="Pc13g03440"
FT                   /product="Pc13g03440 protein"
FT                   /protein_id="CAP91413.1"
FT                   /db_xref="UniParc:UPI0001830510"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z5"
FT                   /transl_table=1
FT                   /translation="MIQLSSDLGLKLCVGIFLLSSLFLTTSYNTTYAFDRPISTSVLVC
FT                   FLTGLTLLVWSRFVSVGSSPSSPTSKRPAIPLAEQFELPSRASTSSFALGDVETRPRAR
FT                   FQPWWIKLALLLGLCGLRIESFRQVTRNTECAPAGYAYAIPFVISLYDYWRNHRSRQVD
FT                   RYVPTQRFEKLPLQVVYSVSRRSFYYLTQSRFRGLIAAAFLSIGGLFASSFSAGTRSTY
FT                   VCPIVLHSASRLRSYRLFNLFADSIILIGITELCQIGAQFDDARRKRALTFLGTGLLGL
FT                   SLVWSVISFWVPDSSPELAGQPMLDLEYSRGAFSQSVLVVILVLSAWHMLPHFDILGVS
FT                   IIGGFVIVYFSSLSALTEPSPFPFISLTHAVLPLAASLTGTLLFLLARVVHDEEPKLYR
FT                   TNVAIQILFAVLFGISLVFAVSKHRLEDMHPIEFLISNGQIQHHNYVAQAAKSKTLGDA
FT                   VTEYRRRYNQHPPPGFDEWYRYATSRSSAIIDDFDQIYHDLLPFRALAPEHIRAMTHEL
FT                   ATNPFNDLGGIRIRNGTAMVQEGIKPTHAWMVAGAADMMKDFAKYLPDMDLVFNLNDEP
FT                   RVAVPWEKISMLNRQTGMQEMISENRVVQTWSTNREEGWAPIEPADQTNITVFTDGAWR
FT                   GVFDPYVSAVCPPSSKARSQRIWNRHDICLSCVAPHSMGQFPLDFNLASEICHQPDLAF
FT                   LHGLLISPASFKVSQELIPVFSQSALTGFNDILFPSPWNYIEKVKYQPTKEHPDPEYGH
FT                   KKNSLYWLGSTSEGVSRFGEWKGMPRQRFAHLINNNTNNQVSILLPADPKENSFRYEIM
FT                   DGSAPTSDLHLQTAVHLADPIVRCGDCDEQAAELSTAGWADFQAHWWHRFLFDLDGAGF
FT                   SGRFLPFLHSHSLPLKTGLFRQWFDSRVTSWLHFVPVDIRLHGLWSTLAYFAGVSAPAS
FT                   EENGPNAPKMRMKAHDRQGKWIAEEGRKWANTALRKEDMEIYFFRLLLEWGRLTDDQRD
FT                   VLGFGH"
     atgatccaat tatcttccga tctcgggctg aagctctgtg tgggaatatt ccttttgagc        60
     tcgctattcc ttactacctc atacaatacc acatacgctt ttgaccgccc catcagtaca       120
     tctgttctgg tctgcttcct cacggggctc actctcttgg tatggagtcg gttcgtttca       180
     gtggggtcgt cgccatcgtc gccaacaagt aaacggcccg ctatccccct tgcggaacaa       240
     tttgagcttc cttcccgcgc atcaacctcc tctttcgcac tgggcgatgt cgagactcgc       300
     cctcgggcac ggttccaacc ctggtggata aagctcgctc ttttgttggg cttgtgtggc       360
     ttgcggatcg agtcgttccg ccaagtaacc cggaatactg aatgcgcacc cgctggatac       420
     gcttacgcta ttcctttcgt catctcgctt tatgactact ggcgcaacca tagatcgcga       480
     caagtagaca gatatgtccc tacccaacga ttcgaaaagc tgccgctgca ggtagtctac       540
     tctgtttctc gccggagctt ctattatctt acgcaaagtc gcttcagagg tttgattgcg       600
     gcagcatttt tgtcgattgg tggtctcttc gcttcatcgt tctcggctgg gactcgatca       660
     acctatgtct gtccgatcgt attacatagc gcatcgcgcc ttcgatcata caggctgttc       720
     aacctgtttg ctgattctat catacttatc ggtattaccg agctatgtca gattggcgct       780
     caattcgatg atgcgcgcag aaaacgagct ttgacgttcc ttggaactgg tctcttgggt       840
     ctttctttgg tctggagtgt tatatcattc tgggtaccag atagctctcc tgaacttgcc       900
     ggtcaaccca tgttggatct agagtattcg cgcggcgctt tcagccagtc cgtgctggtt       960
     gtaatactgg tattgtcggc ctggcacatg ttgccgcatt tcgacatcct tggagtgtca      1020
     atcataggcg gtttcgtgat cgtatacttc tcctctttat cggccctcac cgaaccatca      1080
     ccctttccat ttatctccct aactcacgct gttctcccgt tggctgcatc tttgacgggt      1140
     acccttctat ttcttctggc gcgtgtggtt catgatgaag agccaaaatt ataccgaacc      1200
     aacgttgcga tccaaatatt gttcgccgtg ttatttggga ttagtctcgt tttcgcagtg      1260
     agcaagcatc gtcttgagga tatgcacccg attgaattcc tgatcagtaa tgggcaaatt      1320
     caacatcaca actatgtcgc ccaggcggct aagagcaaga cccttggaga tgctgtcacc      1380
     gaataccgga ggcggtataa ccagcaccca ccaccgggct tcgacgaatg gtatcgatat      1440
     gccactagcc gatcgtcagc tatcatcgat gatttcgatc agatctacca tgacctactt      1500
     cccttccgag cgctggctcc agagcacatc cgcgcaatga cacacgaact ggccacgaac      1560
     cctttcaacg accttggtgg gatcagaatt cgcaatggca cggccatggt gcaagaaggc      1620
     atcaaaccga cccatgcatg gatggtggcg ggtgctgcag acatgatgaa agacttcgcc      1680
     aaatatctcc cagatatgga cttggtattc aatctgaatg atgaaccacg tgttgcagtt      1740
     ccctgggaga aaatatcgat gctgaaccgg cagactggga tgcaagaaat gatctctgaa      1800
     aaccgcgtgg tgcagacttg gtcaaccaac cgagaggagg gctgggcccc gattgaaccg      1860
     gccgatcaaa ccaacattac cgtattcact gacggagcgt ggaggggtgt tttcgaccct      1920
     tatgtgagcg ctgtctgtcc gccttcatca aaggcgcgct ctcagcgaat ctggaatcgc      1980
     catgacatct gtctgtcatg cgtggctccc cattccatgg gccaattccc cctggacttc      2040
     aatctcgctt ccgaaatctg ccaccaacct gaccttgcct tcctccacgg tctcttaatc      2100
     tccccggctt cattcaaagt gtcgcaggaa cttatcccgg tattcagcca gagtgctctc      2160
     accggattta acgacatcct cttcccaagt ccatggaact acatcgagaa ggtaaaatat      2220
     caacctacaa aggaacaccc agatccagaa tacggccaca aaaagaactc cctctactgg      2280
     cttggcagca cgtcagaagg cgtcagccgc ttcggcgagt ggaaaggcat gccacgccag      2340
     cgcttcgcgc acctaataaa caacaacacc aacaatcaag tctccatcct cctcccagca      2400
     gacccaaagg aaaactcctt ccgctacgaa ataatggacg gcagcgcccc aacctcagac      2460
     ctacatctcc aaaccgccgt gcacctcgcc gacccaatcg tccgctgcgg cgactgcgac      2520
     gaacaagccg cagaattaag caccgcaggc tgggcagatt tccaagcaca ctggtggcat      2580
     cgcttcctct tcgacctcga cggcgcaggc ttcagcggcc gcttccttcc cttcctgcac      2640
     agccacagcc tgcccctcaa aacaggtctc ttccgccagt ggttcgactc ccgcgtcacc      2700
     tcgtggctgc atttcgtccc tgtcgatatc cgtcttcatg ggctgtggag tacacttgcg      2760
     tactttgcag gcgtgtctgc tcccgcgtct gaggagaatg gtcctaatgc cccgaagatg      2820
     cgtatgaagg cgcatgatcg gcaggggaag tggattgcgg aagaaggacg gaagtgggca      2880
     aacacggcgt tgaggaagga ggatatggaa atttacttct ttcggttgct cttggagtgg      2940
     ggtcggctta cggatgatca gcgcgatgtt cttgggtttg ggcattga                   2988
//

If you have problems or comments...

PBIL Back to PBIL home page